DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and lmcd1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_012815919.1 Gene:lmcd1 / 100124907 XenbaseID:XB-GENE-966902 Length:352 Species:Xenopus tropicalis


Alignment Length:284 Identity:64/284 - (22%)
Similarity:95/284 - (33%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TNGIGNGSHP--------------QQHSSTVQHQTVTDYARPNKGSQQAH--------------- 305
            ||.|.:|..|              .|..:....:.:....:|..|::.||               
 Frog    97 TNPITSGKDPTFLTVTYEWAPPGLNQKLAMQYMELIPKNMQPVAGTEGAHYRRVQLLRQLPPYDH 161

  Fly   306 ---LTQTI--EETTIVEDSREDQLDSMLGNLQANMSRQGVNTVQKGCCNACEKPIVGQVITALGK 365
               |.|.:  .|.|.:||..:...:..||..:..:........:|.  .:..|...|....|..|
 Frog   162 NPDLCQGLSERERTAMEDFVKRYKEQALGVAEVALPCSAKQQTEKN--GSKSKETNGTAKEAFEK 224

  Fly   366 TWHPEHFTCNHCSQELGTRN----FFERDGFPYCEPDYHNLFSPRCAYCNGAILDKCVTALDKTW 426
            |   |:| |..|.|.| :|:    :.||.||                              ||.|
 Frog   225 T---EYF-CEMCQQPL-SRDAPAVYAERAGF------------------------------DKQW 254

  Fly   427 HTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIM-ENYISALNSQWHPDCF 490
            |...|.|.||.:......:..|:...:|...|.|...|:|.||::.|. |:|....:..||...|
 Frog   255 HPACFMCCQCREPLVNLIYFWRNNSLWCGRHYCESERPRCAGCDQMIFSEDYEQVDSGFWHRHHF 319

  Fly   491 VCRDCRQPFQGGSFFDHEGLPYCE 514
            .|.||.|...|..:...:..|.|:
 Frog   320 SCTDCDQTLSGKPYVLDKAQPLCD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 16/55 (29%)
LIM2_Paxillin_like 407..458 CDD:188723 10/50 (20%)
LIM3_Paxillin_like 466..518 CDD:188724 16/50 (32%)
LIM4_Paxillin 525..576 CDD:188795
lmcd1XP_012815919.1 PET_testin 111..198 CDD:193604 13/86 (15%)
LIM1_Testin_like 229..286 CDD:188726 19/87 (22%)
LIM 292..345 CDD:351770 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.