DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and MGC147631

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001072710.1 Gene:MGC147631 / 780167 XenbaseID:XB-GENE-5814061 Length:422 Species:Xenopus tropicalis


Alignment Length:374 Identity:88/374 - (23%)
Similarity:149/374 - (39%) Gaps:75/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSFSAKTKYLMYINEALACYSPSLSVKIALGV--GLFNNAIRAMGT-EKHQKYIEAAWNREVITC 155
            |.||    |.:.|.|.|.....| .|.:|:||  .:...|:...|: |..::::......:|:||
 Frog   101 LDFS----YSIAIAEELGNIRCS-GVPMAIGVQSDMATPALTRFGSDELKRQFLVPTIAGDVVTC 160

  Fly   156 LAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTADGQN 220
            |.::|...||:..||:|||.  ....:::||     .:|.|..| |..|......||  |:.|..
 Frog   161 LGVSEAGAGSDVASIKTTAV--KKGDDYIIN-----GSKMWTTN-GCQADWMCLLAN--TSAGPP 215

  Fly   221 HGLHGFL-IPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEG 284
            |.....: :|::.       |||.|....||.|:...|...:.|.:.|:|...|:..      ||
 Frog   216 HKNKSLICLPMKT-------PGVQVTKKIEKIGMKSSDTAQIFFEDVRVPSKYLIGE------EG 267

  Fly   285 V---YESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERHGEEMA 346
            :   |:.:..:..::.|.|......|  .|:||:           :.|::.||.|       ...
 Frog   268 MGFTYQMLQFQEERMWGVANVLTPMG--NILQET-----------IDYTSQRKVF-------NQP 312

  Fly   347 ILEYQLHQYRIFPYLAAACVQKIATE-ELTSTYMEIIARSQADSNGFDVLTQNAAEIHALISSSK 410
            :|..|:..:|:         .::||| ||..:   ::.||.|       :.....::..|.|.:|
 Frog   313 VLHNQVVHFRL---------AELATEVELLRS---LLYRSVA-------MYVEGNDVTKLASMAK 358

  Fly   411 PLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHDPLCTYEGDNNVL 459
            ......||:......:..||.|:.....:.:...|...|....|.:.|:
 Frog   359 LKAGRLARELSDSCLQFWGGMGFTDEVLVSRFYRDSRLLSIGAGADEVM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 88/374 (24%)
PLN02443 18..687 CDD:178062 88/374 (24%)
MGC147631NP_001072710.1 CaiA 41..422 CDD:224871 88/374 (24%)
ACAD 43..416 CDD:299127 88/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.