DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and acads

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001003743.1 Gene:acads / 445288 ZFINID:ZDB-GENE-040808-64 Length:405 Species:Danio rerio


Alignment Length:421 Identity:99/421 - (23%)
Similarity:171/421 - (40%) Gaps:86/421 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MDEQKRLCAMQVNRMKHLDLVPKEI-ESLSFSAKTKYLMY--INEALACYSPSLSVKIALGVGLF 128
            :|::.|..|.||..:..:.::..|: |||. .|...||.|  ..|.|:....|..|.:::...|:
Zfish    53 LDKEHRFPAKQVQELGAMGVMAVEVPESLG-GAGMDYLAYCLAVEELSRGCASTGVIVSVNNSLY 116

  Fly   129 NNAIRAMGTEKHQK-YIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEA 192
            ...|...|:|:.:| :|......|.:.|.|::|..:||:..:..|.|..:  ..|:|:|     .
Zfish   117 IGPILKFGSEEQKKQWITPFTTGEKVGCFALSEPGNGSDAGAASTLAQQE--GNEWVLN-----G 174

  Fly   193 AKCWVGNLGKTATVAMTFANLYTADG--QNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNG 255
            .|.|:.| ...|:..:.||   |.|.  ::.|:..||:|       :.:||:.:|...:|.|:..
Zfish   175 TKAWITN-SWDASATVVFA---TTDKSLKHKGISAFLVP-------MPHPGLSLGKKEDKLGIRA 228

  Fly   256 IDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLC 320
            .....::..:.|||..|:|.                |.|.....|:::..:||:||..::.....
Zfish   229 SSTANIILEDCRIPLGNMLG----------------ERGMGFKIAMQTLDSGRLGIAAQALGIAQ 277

  Fly   321 SAAVIAVRYSAVRKQFGPERHGEEMAI------LEYQLHQYRIFPYLAAAC--VQKIATEELTST 377
            :|...|..|:..|..||.. .|:..||      :...:...|:..:.||..  .:|..|:|..  
Zfish   278 AALDCAADYAHKRTAFGAP-IGKLQAIQFKLADMAVAIESARLLTWKAALLRDAKKPFTKEAA-- 339

  Fly   378 YMEIIARSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQM 442
             |..:|.|:|                         .|:|:..|||    ..||.||:  ..:...
Zfish   340 -MAKLAASEA-------------------------ATFASHQAIQ----VLGGMGYV--TDMPAE 372

  Fly   443 RTDHDPLCT--YEGDNNVLGQQASNWLLRQW 471
            |...|...|  |||.:.:.....:|.:|:::
Zfish   373 RHYRDARITEIYEGTSEIQRLVIANNILKEY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 99/421 (24%)
PLN02443 18..687 CDD:178062 99/421 (24%)
acadsNP_001003743.1 CaiA 26..405 CDD:224871 99/421 (24%)
SCAD_SBCAD 29..401 CDD:173847 98/417 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.