DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and Arc42

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:402 Identity:91/402 - (22%)
Similarity:163/402 - (40%) Gaps:81/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LRLIFEKEQGLRIKYKVWRRLENDPLFAHPSRTLPMDEQKRLCAMQVNRMKHLDL----VPKEI- 91
            |..:.|..|.|:   |..|...|:.|..:.::   .|.:......|:.:|..|.:    :|:|: 
  Fly    24 LSALSETHQMLQ---KSCRDFANNELSGNAAK---FDREHLYPEKQIRQMGELGVMAVAIPEELG 82

  Fly    92 -ESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGLFNNAIRAMGTEKHQK-YIEAAWNREVIT 154
             ..|.:.|....:..|:...|.....:||..:|.:|    .:.:.|.:..:| ||......|.:.
  Fly    83 GTGLDYVAYAIAMEEISRGCASAGVIMSVNNSLYLG----PLLSFGNDAQKKDYITPFTTGERVG 143

  Fly   155 CLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTADGQ 219
            |.|::|..:||:..:..|.||  .....||:|     ..|.|:.|..: |..|:.||   |.:.|
  Fly   144 CFALSEPGNGSDAGAASTIAT--DKGDHFVLN-----GTKAWITNAFE-AEAAIVFA---TTNKQ 197

  Fly   220 --NHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTP 282
              :.|:..|::|       .:..|..:|...:|.|:.|.....::|.:..:|::|:|.       
  Fly   198 LKHKGISAFIVP-------KATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKENMLG------- 248

  Fly   283 EGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGP-----ERHG 342
                     |||.....|:::..||||||..::.....:|..:||.|:..|:.||.     :...
  Fly   249 ---------EPGFGFKIAMQTLDAGRIGIAGQALGIGQAALELAVDYAQKRQAFGKPIAKLQSIQ 304

  Fly   343 EEMAILEYQLHQYRIF------------PYLAAACVQKIATEELTS----TYMEIIARSQADSNG 391
            :::|.:...:...|:.            ||...|.:.|:|..|..:    ..::|:       .|
  Fly   305 QKIADMSLAMESARLLTWRAAWLKDQKQPYTKEAAMAKLAASEAATLCSHQCIQIL-------GG 362

  Fly   392 FDVLTQNAAEIH 403
            ...:|..|||.|
  Fly   363 MGYVTDMAAERH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 91/402 (23%)
PLN02443 18..687 CDD:178062 91/402 (23%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 90/399 (23%)
SCAD_SBCAD 29..401 CDD:173847 90/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.