DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and CG4860

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster


Alignment Length:477 Identity:107/477 - (22%)
Similarity:180/477 - (37%) Gaps:107/477 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KRANFDWKRLRLIFEKEQGL----------RIKYKVWRRLENDPLFAHPSRTLPMDEQKRLCAMQ 77
            :|::..|. .|:|....:|:          :|..|..|...|..|   ..:....|.::...|.|
  Fly    13 QRSSGAWS-ARIIAGGNRGIACLAALSETHQILQKTCREFANAEL---APKARHHDREELYPAEQ 73

  Fly    78 VNRMKHLDLVPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGV-GLFNNAIRAMGTEKH- 140
            |.|:..|.|:...:......:...|..|............:|.|.:|| .|:..|::..|||:. 
  Fly    74 VRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQK 138

  Fly   141 QKYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTAT 205
            |.::......|.|...|::|..:||:..:..|||...  ...:.||     ..|.|:.| .|.|:
  Fly   139 QDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQ--GDSYQIN-----GTKAWISN-SKEAS 195

  Fly   206 VAMTFANLYTADG--QNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRI 268
            ..:.||   |.|.  ::.|:..||.| :|      .||:.:.....|.|:.......:|..:..:
  Fly   196 GGIVFA---TVDKSMKHKGITAFLTP-KD------VPGLSIAKKESKMGMRATSTCQLVLEDVHV 250

  Fly   269 PRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVR 333
            ||..:|....|                ....|::|...|||||..::.....:|..:||.||..|
  Fly   251 PRSRVLGAAGD----------------GFKIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKR 299

  Fly   334 KQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEII-----ARSQADSNGFD 393
            ..||  :|...:.:::                 ||:|.   .:|.:||.     ..:....||..
  Fly   300 VAFG--KHLARLQLIQ-----------------QKLAD---MATRVEISRLLTWRAAWLKDNGLP 342

  Fly   394 VLTQNA-AEIHALISSSKPLITWAARDAIQEAREACGGHG---------YLQAAKLGQMRTDHDP 448
            :..:.| |::||..|:     |:.|...||    ..||.|         |.:.|::.::      
  Fly   343 ITKEAAMAKLHASESA-----TFCAHQCIQ----ILGGMGYTTDLPAELYYRNARVTEI------ 392

  Fly   449 LCTYEGDNNVLGQQASNWLLRQ 470
               |||.:.:.....:|.:||:
  Fly   393 ---YEGTSEIQRIVIANAVLRE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 107/477 (22%)
PLN02443 18..687 CDD:178062 107/477 (22%)
CG4860NP_650163.2 CaiA 37..414 CDD:224871 102/452 (23%)
SCAD_SBCAD 39..410 CDD:173847 100/447 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.