DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and zgc:85777

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_998100.1 Gene:zgc:85777 / 405871 ZFINID:ZDB-GENE-040426-2210 Length:432 Species:Danio rerio


Alignment Length:331 Identity:79/331 - (23%)
Similarity:136/331 - (41%) Gaps:77/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VPKEIE----SLSFSAKTKYLMYINEALACYSPSLSVKIALGV--GLFNNAIRAMGT-EKHQKYI 144
            |.|.:|    .|.||    |.:.:.|.|...:.. .:.:|:||  .:...|:...|: |..::::
Zfish   101 VNKPVEYGGLGLDFS----YSLAVAEELGNINCG-GIPMAIGVQSDMATPALARFGSAELKKEFL 160

  Fly   145 EAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMT 209
            :.....:|:.||.::|...||:..||:|.|.  ....|:|||     ..|.|..| |..|.....
Zfish   161 QPTIMGDVVVCLGVSETGAGSDVASIKTKAV--RKGDEYVIN-----GGKMWTTN-GTQADWMCL 217

  Fly   210 FANLYTADGQNHGLHGFL-IPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNL 273
            .||  |:||..|.....: :|::       .|||.:.....|.|::..|...|.|.:.|:|..|:
Zfish   218 LAN--TSDGPPHKNKSLICLPMK-------LPGVHIARKINKIGMHSSDTAEVFFDDVRVPCSNV 273

  Fly   274 LNRTSDVTPEGV---YESVFTEPGKVLGAA-----LESFSAGRIGIMQESANTLCSAAVIAVRYS 330
            :.:      ||:   |:.:..:..::.|.|     :|.       ::||:           ::|:
Zfish   274 IGQ------EGMGFTYQMLQFQEERLWGVANILTVMEK-------VVQET-----------IQYT 314

  Fly   331 AVRKQFG-PERHGE-----------EMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIA 383
            ..||.|. |..|.:           |:.:|...||:.... |:....|.|:|:  :.......:|
Zfish   315 RQRKIFNQPILHNQVVHFRLAELQMEIELLRSLLHRATAL-YIKGNDVTKLAS--MAKLKAGRLA 376

  Fly   384 RSQADS 389
            |..|||
Zfish   377 RELADS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 79/331 (24%)
PLN02443 18..687 CDD:178062 79/331 (24%)
zgc:85777NP_998100.1 CaiA 52..422 CDD:224871 79/331 (24%)
ACAD 54..426 CDD:299127 79/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.