DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and CG6638

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:455 Identity:103/455 - (22%)
Similarity:179/455 - (39%) Gaps:115/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NDPLFAHPSRTLPMDE-------------QKRLC--AMQVNRMKHL-DLVP--KEIESLSFSAKT 100
            ||.:|.       :||             ||.|.  |.:::::.:. |:.|  |::.:|.|...|
  Fly    33 NDAMFG-------LDEDRQKLREVAFNFFQKELAPLAKEIDKLDNFKDMRPFWKKLGALGFLGIT 90

  Fly   101 ----------KYLMY--INEALACYSPSLSVKIALGVGLFNNAIRAMGT-EKHQKYIEAAWNREV 152
                      .||.:  |.|..:..:..:::.......|..|.:...|| |:.:||:....:.|.
  Fly    91 AEPDFGGTGGSYLDHCIIMEEFSRAAGGVALSYGAHSNLCINQLTKNGTPEQKEKYLPKLCSGEH 155

  Fly   153 ITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTAD 217
            :..||::|...||:..|::..|  :.....:|:|     .:|.|:.| |..|...:.:|.. ...
  Fly   156 VGGLAMSEPGAGSDVVSMKLRA--ERKGDYYVLN-----GSKFWITN-GSDADTLIVYAKT-GGS 211

  Fly   218 G--QNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDV 280
            |  ..||:..|::.       .::.|..|....:|.|:.|.....:||.:.::|..|:|.:.:  
  Fly   212 GVPDKHGITAFIVE-------TAWEGFSVAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQEN-- 267

  Fly   281 TPEGVYESVFTEPGKVLGAALE----SFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERH 341
              .|||         ||.:.|:    ..:||.:|:||       :|..:|..|:..|||.     
  Fly   268 --RGVY---------VLMSGLDFERLVLAAGPVGLMQ-------AACDVAFDYAHQRKQM----- 309

  Fly   342 GEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIARSQADSNGFDVLTQNAAEIHALI 406
              ...|.|:||.|.::        .....|.....:|:..:|||      .|...::..:...:|
  Fly   310 --NKLIGEFQLLQGKM--------ADMYTTLSACRSYLYTVARS------CDAGNRSPKDCAGVI 358

  Fly   407 SSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHDPLCTYEGDNNVLGQQASNWLLRQW 471
            ..:....|..|.||||    ..||:||:.....|::..|..   .||     :|...|.  :|:|
  Fly   359 LYTAEKATKVALDAIQ----ILGGNGYINENPTGRILRDAK---LYE-----IGAGTSE--IRRW 409

  Fly   472  471
              Fly   410  409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 103/455 (23%)
PLN02443 18..687 CDD:178062 103/455 (23%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 103/455 (23%)
IVD 38..417 CDD:173845 100/450 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.