DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and CG9547

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:444 Identity:97/444 - (21%)
Similarity:184/444 - (41%) Gaps:82/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FDWK-RLRL---IFEKEQGLRIKYKVWRRLENDPLFAHPSRTLPMDEQKRLCAMQVNRMKHLDLV 87
            |:|: .|.|   :.|:|..:|..::.:.:.|..|.....:|....|::   ...::..:..|...
  Fly    29 FNWQDPLNLESQLTEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKK---IMEEIGSLGVLGCT 90

  Fly    88 PK-----EIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGLFNNAIRAMGTEKH-QKYIEA 146
            .|     .:.|:::...|:.:..::.|   |..::||:.:|.:|    ||...|:|:. |:|:.:
  Fly    91 IKGYGCAGVSSVAYGLLTREVERVDSA---YRSAVSVQSSLAMG----AIYDFGSEEQKQRYLPS 148

  Fly   147 AWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFA 211
            ....::|....:||.:|||:...:.|.|.||..::.:::|     .:|.|:.: ...|.|.:.:|
  Fly   149 MAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN-----GSKTWITS-APIADVIVVWA 207

  Fly   212 NLYTADGQNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNR 276
            .  ..||:   :.|||:   |.|  :|..|:....|..|..|.....|.::....|:|.:.||..
  Fly   208 K--CEDGK---VRGFLV---DRK--ISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPN 262

  Fly   277 TSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERH 341
            .:.          |:.|...|..|....:.|.:|..:       :...||.:|:..|||||.   
  Fly   263 VAG----------FSGPFSCLNNARYGIAWGALGAAE-------TCVEIARQYTLDRKQFGR--- 307

  Fly   342 GEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIARSQADSNGFDVLTQNAAEIHA-- 404
                             |..|...:||...:.:|    ||....||..:...:..|   ::|.  
  Fly   308 -----------------PLAANQLIQKKLADAIT----EIALGLQACLHVGRLKDQ---KLHTPD 348

  Fly   405 LISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHDPLCTYEGDNNV 458
            :||..|...|..:.|..::.|:..|.:|......:.:...:.:.:.||||.:::
  Fly   349 MISLLKRNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 97/444 (22%)
PLN02443 18..687 CDD:178062 97/444 (22%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 97/444 (22%)
CaiA 41..417 CDD:224871 93/432 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.