DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and Acad9

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_861433.2 Gene:Acad9 / 294973 RGDID:727973 Length:625 Species:Rattus norvegicus


Alignment Length:433 Identity:106/433 - (24%)
Similarity:170/433 - (39%) Gaps:75/433 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MDEQKRLCAMQVNRMKHLDL----VPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGL 127
            :|::.::.|..:.::|.|.|    ||:|...|..| .|.|.. :.|.:: ...|::|.:|....:
  Rat    91 IDQEGKIPADTLAKLKSLGLFGIQVPEEYGGLGLS-NTMYAR-LGEIIS-MDASITVTLAAHQAI 152

  Fly   128 FNNAIRAMGTEKHQ-KYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFE 191
            ....|..:|.|:.: ||:....:.|.|....:||.:.||:..||:|.||.....:.||:|     
  Rat   153 GLKGIILVGNEEQKAKYLPKLSSGEHIAAFCLTEPASGSDAASIQTRATLSEDKKYFVLN----- 212

  Fly   192 AAKCWVGNLGKTATVAMTFANLYTADGQNHGLHGFLIPIRDPKTLL----SYPGVLVGDIGEKCG 252
            .:|.|:.| |..|.:...||.....|...        .|:|..|..    .:.|:..|...:|.|
  Rat   213 GSKVWITN-GGLANIFTVFAKTEVVDSDG--------SIKDKMTAFIVERDFGGITNGKPEDKLG 268

  Fly   253 LNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESAN 317
            :.|.:...|.|.|.|:|.:|:|.                |.|.....|:...::||..:....|.
  Rat   269 IRGSNTCEVHFENTRVPVENVLG----------------EVGGGFKVAMNILNSGRFSMGSAVAG 317

  Fly   318 TLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEII 382
            .|.........|:..||||  .|:..|..:::.:.          |...||....|    .|..:
  Rat   318 MLKKLIEQTAEYACTRKQF--NRNLSEFGLIQEKF----------ALMAQKAYVME----SMAYL 366

  Fly   383 ARSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHD 447
            .....|..||...:..||.:....|.       ||...:.||.:..||.||::.....:|..|..
  Rat   367 TSGMLDQPGFPDCSIEAAMVKVFSSE-------AAWQCVSEALQILGGSGYMKDYPYERMLRDAR 424

  Fly   448 PLCTYEGDNNVL-------GQQASNWLLRQWSAKELETPIGSV 483
            .|..:||.|.:|       |.|.:..:|.. ..|||::  |:|
  Rat   425 ILLIFEGTNEILRLFIALTGLQHAGRILTS-RIKELKS--GNV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 106/433 (24%)
PLN02443 18..687 CDD:178062 106/433 (24%)
Acad9NP_861433.2 VLCAD 42..449 CDD:173850 100/413 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.