DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and Acad9

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_766266.3 Gene:Acad9 / 229211 MGIID:1914272 Length:625 Species:Mus musculus


Alignment Length:432 Identity:104/432 - (24%)
Similarity:173/432 - (40%) Gaps:73/432 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MDEQKRLCAMQVNRMKHLDL----VPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGL 127
            :|::.::....:.::|.|.|    ||:|...|..| .|.|.. :.|.:: ...|::|.:|....:
Mouse    91 IDQEGKIPVDTLEKLKSLGLFGIQVPEEYGGLGLS-NTMYAR-LGEIIS-LDASITVTLAAHQAI 152

  Fly   128 FNNAIRAMGTEKHQ-KYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFE 191
            ....|..:|.|:.: ||:....:.|.|....:||.:.||:..||:|.||.....:.|::|     
Mouse   153 GLKGIILVGNEEQKAKYLPKLSSGEHIAAFCLTEPASGSDAASIQTRATLSEDKKYFILN----- 212

  Fly   192 AAKCWVGNLGKTATVAMTFANLYTAD---GQNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGL 253
            .:|.|:.| |..|.:...||.....|   .:...:..|::. ||      :.|:..|...:|.|:
Mouse   213 GSKVWITN-GGLANIFTVFAKTEVVDSDGSKTDKMTAFIVE-RD------FGGITNGKPEDKLGI 269

  Fly   254 NGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANT 318
            .|.:...|.|.|.|:|.:|:|.                |.|.....|:...::||..:....|..
Mouse   270 RGSNTCEVHFENTRVPVENVLG----------------EVGGGFKVAMNILNSGRFSMGSAVAGM 318

  Fly   319 LCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIA 383
            |.....:...|:..||||  .|:..|..:::.:.          |...||....|    .|..:.
Mouse   319 LKKLIELTAEYACTRKQF--NRNLSEFGLIQEKF----------ALMAQKAYVME----SMAYLT 367

  Fly   384 RSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHDP 448
            ....|..||...:..||.:....|.       ||...:.||.:..||.||::.....:|..|...
Mouse   368 SGMLDQPGFPDCSIEAAMVKVFSSE-------AAWQCVSEALQILGGSGYMKDYPYERMLRDARI 425

  Fly   449 LCTYEGDNNVL-------GQQASNWLLRQWSAKELETPIGSV 483
            |..:||.|.:|       |.|.:..:|.. ..|||::  |:|
Mouse   426 LLIFEGTNEILRLFIALTGLQHAGRILTS-RIKELKS--GNV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 104/432 (24%)
PLN02443 18..687 CDD:178062 104/432 (24%)
Acad9NP_766266.3 VLCAD 42..449 CDD:173850 98/412 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.