DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and acdh-9

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_493832.1 Gene:acdh-9 / 173466 WormBaseID:WBGene00017874 Length:409 Species:Caenorhabditis elegans


Alignment Length:326 Identity:79/326 - (24%)
Similarity:129/326 - (39%) Gaps:68/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 CLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTADGQ 219
            ||  ||...||:..|||||||  .....:|:|     .:|.::...|    .:..:..:...||.
 Worm   145 CL--TEPDAGSDAASIRTTAT--KKGDYYVVN-----GSKAFISGAG----TSNNYFVMMRQDGA 196

  Fly   220 NHGLHG-FLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTPE 283
            ..|..| |.:.|.|.....||     |...:|.|.|......:.|.:.::|..|.:.:       
 Worm   197 APGAKGIFCLMIEDGTEGFSY-----GKKEDKLGWNSQPTRILTFEDCKVPITNQIGK------- 249

  Fly   284 GVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERHGEEMAIL 348
                     .|.....|:...:.|||.|...|......:..:|:.:...|||||       .::.
 Worm   250 ---------DGFGFNIAMAGLNGGRINIASCSLGAAQRSMDLAIEHLKYRKQFG-------KSLA 298

  Fly   349 EYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIARSQADSNGFDVLTQNAAEIHALISSSKPLI 413
            ::|.:|:::         .::||:..||   .:|.|:.|:.     |..:..|..||.:.:|...
 Worm   299 DFQYNQFKL---------AELATKLYTS---RLIVRNAAEQ-----LDNDDPEKVALCAMAKLHA 346

  Fly   414 TWAARDAIQEAREACGGHGYLQAAKLGQMRTD---HDPLCTYEGDNNVLGQQASNWLLRQ---WS 472
            |....|.:..|.:..||:|:|:...:.|...|   |..|   ||.|.::....|..||.:   ||
 Worm   347 TDNCFDVVNGALQMFGGYGFLKDYPVQQYLRDIRVHQIL---EGTNEMMRLLISRDLLTKDVFWS 408

  Fly   473 A 473
            :
 Worm   409 S 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 79/326 (24%)
PLN02443 18..687 CDD:178062 79/326 (24%)
acdh-9NP_493832.1 CaiA 26..401 CDD:224871 75/316 (24%)
IBD 27..403 CDD:173851 77/318 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.