DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and acdh-4

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:309 Identity:73/309 - (23%)
Similarity:119/309 - (38%) Gaps:81/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KIALGVG--------LFNNAIRAMGTEKH-QKYIEAAWNREVITCLAITELSHGSNTKSIRTTAT 175
            |:...||        ||...|..:||||. :||:...:...| ...|::|...||:..:::|||.
 Worm   114 KVDASVGAMVDVHNTLFIPLIIELGTEKQKEKYLPKCYTSSV-GSFALSETGSGSDAFALKTTAK 177

  Fly   176 YDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTADGQNHGLHGFLIPIRDPKTLLSYP 240
            .|  ..::|||     .:|.|:.|..::.|. :.|||...:.|.. |:..|::. :..|      
 Worm   178 KD--GDDYVIN-----GSKMWISNSEQSETF-LVFANADPSKGYK-GITCFIVE-KGTK------ 226

  Fly   241 GVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFS 305
            |..:|...:|.|:.......:.|.|.|:.:..:|.                |.||....|:|..:
 Worm   227 GFTIGKHEDKLGVRSSSTCPLHFDNVRVHKSAILG----------------EFGKGYKYAIEYLN 275

  Fly   306 AGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIA 370
            ||||||..:............:.|...|:|||       ..|:::|..|::              
 Worm   276 AGRIGIGAQMLGLAQGCFDQTIPYLQQREQFG-------QRIIDFQGMQHQ-------------- 319

  Fly   371 TEELTSTYMEIIARSQADSNGFDVLTQNAAEI--HALISSSKPLITWAA 417
                       ||:.:.:.....:|..|||.:  |.|     |.:..||
 Worm   320 -----------IAQVRTEIEAARLLVYNAARMKQHGL-----PFVREAA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 73/309 (24%)
PLN02443 18..687 CDD:178062 73/309 (24%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 73/309 (24%)
ACAD 43..359 CDD:299127 73/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.