DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17544 and Acadm

DIOPT Version :9

Sequence 1:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_031408.1 Gene:Acadm / 11364 MGIID:87867 Length:421 Species:Mus musculus


Alignment Length:351 Identity:82/351 - (23%)
Similarity:134/351 - (38%) Gaps:110/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 IRAMGTEKHQKYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCW 196
            |.|...::.:||:.....:.::....:||.|.||:..:|:|.|  :....|:|||     ..|.|
Mouse   134 ILAGNDQQKKKYLGRMTEQPMMCAYCVTEPSAGSDVAAIKTKA--EKKGDEYVIN-----GQKMW 191

  Fly   197 VGNLGKTATVAMTFANLYTADGQNHGLHGFLI----PIRDPKTLLS-----------YPGVLVG- 245
            :.|.||        ||.|           ||:    |  |||...|           .||:.:| 
Mouse   192 ITNGGK--------ANWY-----------FLLARSNP--DPKVPASKAFTGFIVEADTPGIHIGK 235

  Fly   246 ---DIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGA---ALESF 304
               ::|::|.    |...:.|.:.|:|::|:|      ..||....:      .:||   ...:.
Mouse   236 KELNMGQRCS----DTRGIAFEDVRVPKENVL------IGEGAGFKI------AMGAFDRTRPTV 284

  Fly   305 SAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGP---ERHGEEMAILEYQLHQYRIFPYLAAACV 366
            :||.:|:.|.:.:.       |.:|:..||.||.   |..|     :.:.|.:..:...||....
Mouse   285 AAGAVGLAQRALDE-------ATKYALDRKTFGKLLVEHQG-----VSFLLAEMAMKVELARLSY 337

  Fly   367 QKIATE---ELTSTYMEIIARSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQEAREAC 428
            |:.|.|   ...:||...||::.|.    |:..|                  .|.||:|    ..
Mouse   338 QRAAWEVDSGRRNTYYASIAKAFAG----DIANQ------------------LATDAVQ----IF 376

  Fly   429 GGHGYLQAAKLGQMRTDHDPLCTYEG 454
            ||:|:.....:.::..|......|||
Mouse   377 GGYGFNTEYPVEKLMRDAKIYQIYEG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17544NP_001163015.1 AXO 16..670 CDD:173839 82/351 (23%)
PLN02443 18..687 CDD:178062 82/351 (23%)
AcadmNP_031408.1 CaiA 39..420 CDD:224871 82/351 (23%)
MCAD 41..418 CDD:173846 82/351 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 278..281 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.