DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fon and NUP49

DIOPT Version :9

Sequence 1:NP_001163013.1 Gene:fon / 35211 FlyBaseID:FBgn0032773 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_011343.1 Gene:NUP49 / 852703 SGDID:S000003140 Length:472 Species:Saccharomyces cerevisiae


Alignment Length:359 Identity:91/359 - (25%)
Similarity:126/359 - (35%) Gaps:122/359 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YGGGYSGSFGAGVDGASAQVDDSALGKLESSYDSVGATESAE--GASAGGLGGAVETLGGSAGTN 113
            :|...:.|..||  |...|...::.|...:.: |.|.|::.:  |.|.|||.||..  .||.|  
Yeast     2 FGLNKASSTPAG--GLFGQASGASTGNANTGF-SFGGTQTGQNTGPSTGGLFGAKP--AGSTG-- 59

  Fly   114 TIGAGVGSSFG----SNFASGFGGQNAASFG-----AQNAAGFGAQNAASFGAQNAASFGSSFSS 169
                |:|:|||    .:..:.|||......|     ..|.|..|   ...|||.:.::.||.|.|
Yeast    60 ----GLGASFGQQQQQSQTNAFGGSATTGGGLFGNKPNNTANTG---GGLFGANSNSNSGSLFGS 117

  Fly   170 NAAFQTSSASNFGSTAAHQVGSNVEFADNANAGNKVDFGGVNAVDSSAQLLSGVQTVQSVPTSEY 234
            |.| |||... ||:...:.:.::....:||:||.   ||...|                      
Yeast   118 NNA-QTSRGL-FGNNNTNNINNSSSGMNNASAGL---FGSKPA---------------------- 155

  Fly   235 YRHEKIVSTPQQVVYTIPGGSQRYVHHEERIVEQPTQVTQTVPVQTAHYYQRKVTTTASAPQLVQ 299
                              ||:..:.:                            |:|:|||    
Yeast   156 ------------------GGTSLFGN----------------------------TSTSSAP---- 170

  Fly   300 PVASSRLTYGSNAAST--FGSNAASNFGSNAATNFGSNAATNFGSN-AAFNSQFGSSYGQNFQQN 361
              |.::..:|:..|.|  ||:||     .|..|..|.     |||. ....|.||||...|...|
Yeast   171 --AQNQGMFGAKPAGTSLFGNNA-----GNTTTGGGL-----FGSKPTGATSLFGSSNNNNNNNN 223

  Fly   362 SQ-----LSQLLSQTQQAARQQAALQAASANQVQ 390
            |.     ...|....||..:||..:|.|..|..|
Yeast   224 SNNIMSASGGLFGNQQQQLQQQPQMQCALQNLSQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fonNP_001163013.1 None
NUP49NP_011343.1 Nucleoporin_FG2 29..>289 CDD:406391 84/330 (25%)
V_Alix_like <267..465 CDD:353824
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.