DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fon and SAR3

DIOPT Version :10

Sequence 1:NP_609959.1 Gene:fon / 35211 FlyBaseID:FBgn0032773 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_178183.2 Gene:SAR3 / 844407 AraportID:AT1G80680 Length:1046 Species:Arabidopsis thaliana


Alignment Length:79 Identity:22/79 - (27%)
Similarity:31/79 - (39%) Gaps:20/79 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 SLLSGQVGGQQSLLSGSLLSGQQNLGLGLNAAQTG------------------QVVGAS-SVGAG 499
            :||....|..:| ..||:|..|||..|.:..::||                  .||.|: .:|..
plant   310 ALLEYNPGNDKS-SPGSILMVQQNKNLAVRKSKTGGFELDISHVTPLTDNYSRNVVDAALFMGRS 373

  Fly   500 LSAGAGNLGSGYRT 513
            ..||.|..|..:.|
plant   374 FRAGWGPNGVLFHT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fonNP_609959.1 None
SAR3NP_178183.2 Nucleoporin2 51..187 CDD:461171
Nup96 579..858 CDD:463462
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.