DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fon and si:ch211-216l23.2

DIOPT Version :10

Sequence 1:NP_609959.1 Gene:fon / 35211 FlyBaseID:FBgn0032773 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001038534.1 Gene:si:ch211-216l23.2 / 565061 ZFINID:ZDB-GENE-030131-3806 Length:474 Species:Danio rerio


Alignment Length:100 Identity:21/100 - (21%)
Similarity:35/100 - (35%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GNKVDFGGVNAVDSSAQLLSGVQTVQSVPTSEYYRHEKIVSTPQQVVYTIPGGSQRYVHHEERIV 266
            |.:...||.....|:.........|:...|.|:.:.|...|..:.:.|:   ....|.|...:|.
Zfish    10 GRRQKHGGGGGQKSNKSFRRPPYPVRQERTEEHLQLESFQSLEETIDYS---SIVDYEHSSHKIT 71

  Fly   267 EQPTQVTQTVPVQTAH------YYQRKVTTTASAP 295
            ..|:...:...|.|.|      :||:....:|..|
Zfish    72 GLPSASREQYDVSTQHPELYERFYQQLCGESARRP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fonNP_609959.1 None
si:ch211-216l23.2NP_001038534.1 PHA03307 280..>471 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.