DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fon and Neos

DIOPT Version :9

Sequence 1:NP_001163013.1 Gene:fon / 35211 FlyBaseID:FBgn0032773 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster


Alignment Length:115 Identity:27/115 - (23%)
Similarity:38/115 - (33%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 VTTTASAPQLVQPVASSRLTYGSNAASTFGSNAASNFGSNAATNFGSNAATNFGSNAAFNSQFGS 352
            |.|......:.||       ||    ...||....|:|   ...|.:....|..::|...|    
  Fly    29 VCTREELVSICQP-------YG----KVLGSMVQKNYG---FVQFETEELANKAASALHKS---- 75

  Fly   353 SYGQNFQQNSQLSQLLSQTQQAARQQAALQAASANQVQAGSGYAAGSQGG 402
                .|:||     :|:....:.:.:||...|..|..|.|.   ...|||
  Fly    76 ----TFKQN-----MLTVRNASIKSKAANAIAKRNSNQGGQ---VTVQGG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fonNP_001163013.1 None
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 27/115 (23%)
RRM_SF 20..78 CDD:388407 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.