DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fon and Ncoa5

DIOPT Version :9

Sequence 1:NP_001163013.1 Gene:fon / 35211 FlyBaseID:FBgn0032773 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001100013.1 Gene:Ncoa5 / 296372 RGDID:1307702 Length:578 Species:Rattus norvegicus


Alignment Length:175 Identity:48/175 - (27%)
Similarity:62/175 - (35%) Gaps:53/175 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 QPTQVTQTVPVQTAHYYQRKVTTTASAPQLVQPVASSRLTYGSNAASTFGSNAASNFGSNAATNF 332
            ||.|..|.:|         ..|.|.:||...|....:::      .|.|.|.|.:...|:|:.:.
  Rat   405 QPLQSGQVLP---------SATPTPAAPPTSQQELQAKI------LSLFNSGAVAANSSSASPSV 454

  Fly   333 GSNAATNFGSNAAFNSQFGSSYGQNFQQNSQLSQLLSQTQQAARQQAALQAASANQV-----QAG 392
            .:                |||..|||...:.     ||.||  |.|     ||.||.     |||
  Rat   455 AT----------------GSSQNQNFSTAAN-----SQPQQ--RPQ-----ASGNQPPNIVGQAG 491

  Fly   393 SGYAAGSQGGFNSGYNSAFNSGSQFGFNSASSLNSASSLNSASTG 437
            |....|.:.|..|  ...|...|.   ..|.:.|.||....:|||
  Rat   492 SARNMGPRPGAPS--QGLFGQPSS---RLAPASNMASQRPVSSTG 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fonNP_001163013.1 None
Ncoa5NP_001100013.1 HisS <185..255 CDD:223202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.