DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and KIN1

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_010407.1 Gene:KIN1 / 851700 SGDID:S000002529 Length:1064 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:69/326 - (21%)
Similarity:132/326 - (40%) Gaps:84/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 VSVEQQHPEELHRRISELTVERCRVRLSSL--------LQEGTFGRVYRGTYNDTQDV-LVKTVA 348
            ||..|..|::.||:              ||        :..|:.|:|....:..|.:| .||.|.
Yeast   102 VSSSQGMPKQFHRK--------------SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVN 152

  Fly   349 Q------HASQM-------QVLLLLQE------------------GMLLYGASHPGILSVLGV-S 381
            :      |..||       |.:|..|:                  |.:||   ||.|..:..: :
Yeast   153 RATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLGQILY---HPHICRLFEMCT 214

  Fly   382 IEDHTTPFVLYPALNNTRNLKQFLLDPACAR-TVTTIQIVMMASQLSMALDHLHSHGVVHKDIAT 445
            :.:|.  ::|:..::..:     |||..... ::...|....|..::.||.:||::.:||:|:..
Yeast   215 LSNHF--YMLFEYVSGGQ-----LLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKI 272

  Fly   446 RNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENR------PVKWMSLEALQHKQFSEAS-DSW 503
            .|.:|.|...:|:.|..||.         :.||..:      .:.:.:.|.|:...::... |.|
Yeast   273 ENIMISDSSEIKIIDFGLSN---------IYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVW 328

  Fly   504 AFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQ 568
            :|||:::.| ...|.|:.:.:...:...:|.| ::..|.:...|:.::::....:.|..|.|..|
Yeast   329 SFGVVLFVL-VCGKVPFDDENSSVLHEKIKQG-KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQ 391

  Fly   569 L 569
            :
Yeast   392 V 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 63/309 (20%)
Pkinase_Tyr 317..573 CDD:285015 63/302 (21%)
KIN1NP_010407.1 STKc_Kin1_2 118..398 CDD:270979 61/296 (21%)
MARK_C_like 890..1062 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.