DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and EDR1

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_563824.1 Gene:EDR1 / 837393 AraportID:AT1G08720 Length:933 Species:Arabidopsis thaliana


Alignment Length:372 Identity:91/372 - (24%)
Similarity:154/372 - (41%) Gaps:78/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 AYCVKGAANKRQH-HQH---GGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRK 290
            |..|.|..|...| |.|   ....:.|....||..|....||:.|.:|                 
plant   600 AAVVHGQQNDESHIHDHRKYTSDDISTGCDPRLKDHESTSSSLDSTSY----------------- 647

  Fly   291 VPVSVEQQHPEELHRRISELTVERCRVRLSSL-----LQEGTFGRVYRGTYNDTQDVLVKTVAQH 350
                  :..|:.|    .:..|..|.:..:.|     :..|::|.||...::.|:..:.|.:.|.
plant   648 ------RNDPQVL----DDADVGECEIPWNDLVIAERIGLGSYGEVYHADWHGTEVAVKKFLDQD 702

  Fly   351 ASQMQVLLLLQEGMLLYGASHPGILSVLG-------VSIEDHTTPFV----LYPALNNTRNLKQF 404
            .|...:.....|..::....||.::..||       :||   .|.|:    ||..|:..::    
plant   703 FSGAALAEFRSEVRIMRRLRHPNVVFFLGAVTRPPNLSI---VTEFLPRGSLYRILHRPKS---- 760

  Fly   405 LLDPACARTVTTIQIVMMASQLSMALDHLHSH--GVVHKDIATRNCVIDDQLRVKLSDSSLSR-- 465
                    .:...:.:.||..::|.::.||:.  .:||:|:.|.|.::|:...||:.|..|||  
plant   761 --------HIDERRRIKMALDVAMGMNCLHTSTPTIVHRDLKTPNLLVDNNWNVKVGDFGLSRLK 817

  Fly   466 -DLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEME 529
             :.|.|..:..|..|     ||:.|.|:::..:|..|.::|||::|||.| .:.|:..::|.::.
plant   818 HNTFLSSKSTAGTPE-----WMAPEVLRNEPSNEKCDVYSFGVILWELAT-LRLPWRGMNPMQVV 876

  Fly   530 HYLKDGY---RLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCL 573
            ..:  |:   ||..|......:..|:..||...|..||:||||...|
plant   877 GAV--GFQNRRLEIPKELDPVVGRIILECWQTDPNLRPSFAQLTEVL 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 74/288 (26%)
Pkinase_Tyr 317..573 CDD:285015 71/279 (25%)
EDR1NP_563824.1 EDR1 129..327 CDD:291079
Pkinase_Tyr 669..921 CDD:285015 71/274 (26%)
STKc_MAP3K-like 675..921 CDD:270901 70/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.