DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and Eph

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster


Alignment Length:600 Identity:129/600 - (21%)
Similarity:241/600 - (40%) Gaps:118/600 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQLHSGSEVAAHLNVF----------------------LN-PVEVMRLLGVSAEVYYVREGHINN 76
            :|:|:.:.| :|:|.|                      || |:::..:....||:.:..|..:.:
  Fly   469 VQIHAINSV-SHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQAEIVFTTESVLLS 532

  Fly    77 YALNFIVPVPANVKDISFTWQSLAGRGLPYSINVV----SSDQEVLPRPAINVSHS-----GEIP 132
            ...|..:....| ||....|........|.....|    ..:.:.:.:.|:|...:     |.:.
  Fly   533 TVFNLRILAITN-KDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLE 596

  Fly   133 TTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQ 197
            .|  .:...::|.                .|....:.:::::.:        :.:.:....||..
  Fly   597 NT--EYGFQVRCK----------------TNNGFGSYSNMIYAQ--------TLQSVGSVYDDSV 635

  Fly   198 LLETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHP 262
            .:..:    .|.|  |.||         |.::.:.:......|..||.......|:       |.
  Fly   636 QIRFI----AGAI--VTGV---------LFLVIFIIATVYFMRSKHQDDLDKKSTN-------HL 678

  Fly   263 PC----QSSMGSAAYMTP-------SIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCR 316
            |.    .|:..::...||       ::..|:.|:|.....|.:.|.  |.:..|..:. .::...
  Fly   679 PLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYED--PNQAIREFAR-EIDANY 740

  Fly   317 VRLSSLLQEGTFGRVYRGTY----NDTQ--DVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGIL 375
            :.:.:::..|.||.|.||..    |..|  ||.:||:...:|:......|.|..::....||.::
  Fly   741 ITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVI 805

  Fly   376 SVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACART----VTTIQIVMMASQLSMALDHLHSH 436
            .:.||  ...:.|.::........:|..||      |.    ..|:|:::|...::..:.:|...
  Fly   806 YLQGV--VTRSNPVMIITEYMENGSLDTFL------RVNDGKFQTLQLIVMLRGIASGMSYLSDM 862

  Fly   437 GVVHKDIATRNCVIDDQLRVKLSDSSLSRDL-FPSD-YNCLGDSENRPVKWMSLEALQHKQFSEA 499
            ..||:|:|.||.:::.||..|::|..|||:: ..|| |...|.  ..||:|.:.||:..::|:.|
  Fly   863 NYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAYTTRGG--KIPVRWTAPEAIAFRKFTSA 925

  Fly   500 SDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERP 564
            ||.|::||::||:.:..::||......::...::.||||..|.:||:.|:.:|..||......||
  Fly   926 SDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRP 990

  Fly   565 TFAQLQSCLSEFYSQ 579
            |||.:.|.|.....|
  Fly   991 TFASIVSTLDNLARQ 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745 22/167 (13%)
PKc_like 310..580 CDD:304357 79/281 (28%)
Pkinase_Tyr 317..573 CDD:285015 78/267 (29%)
EphNP_524625.3 EphR_LBD 85..260 CDD:198439
FN3 387..476 CDD:238020 2/6 (33%)
FN3 536..623 CDD:238020 13/113 (12%)
EphA2_TM 644..736 CDD:291255 21/112 (19%)
PTKc_EphR 736..1002 CDD:270629 79/275 (29%)
Pkinase_Tyr 741..999 CDD:285015 78/267 (29%)
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.