DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and InR

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster


Alignment Length:586 Identity:134/586 - (22%)
Similarity:234/586 - (39%) Gaps:135/586 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EVYYVRE--GHINNYALNFIV----PVPA-NVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPA 122
            :.::|.|  .|...||: |:|    .:|: .::|.||.....:.....:.........:::....
  Fly  1148 QTHFVFEKLRHFTRYAI-FVVACREEIPSEKLRDTSFKKSLCSDYDTVFQTTKRKKFADIVMDLK 1211

  Fly   123 INVSHSG--EIPTTIQ------------TWSIAL-----------KCSGLKAAEVDVTVSLEVVL 162
            :::.|:.  |.|..::            |:.:|.           ||  :.||:.:.|....:.|
  Fly  1212 VDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYKLQKPDQVEEKKC--IPAADFNQTAGYLIKL 1274

  Fly   163 NRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVM--LPPTGLITLVVGVSVAMGSVCL 225
            |..|.:..   .|...|....|..|.....|:.|.....|.  |...||..|:|.:   .|.||.
  Fly  1275 NEGLYSFR---VRANSIAGYGDFTEVEHIKVEPPPSYAKVFFWLLGIGLAFLIVSL---FGYVCY 1333

  Fly   226 LLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRK 290
            |           :||:         ..|:...:||.                 :.|.:.|.    
  Fly  1334 L-----------HKRK---------VPSNDLHMNTE-----------------VNPFYASM---- 1357

  Fly   291 VPVSVEQQHPEE---LHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYND------TQDVLVKT 346
                  |..|::   |...|.:|          :.|.:|:||.||.|....      .::..:||
  Fly  1358 ------QYIPDDWEVLRENIIQL----------APLGQGSFGMVYEGILKSFPPNGVDRECAIKT 1406

  Fly   347 VAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFL------ 405
            |.::|:..:....|.|..::.......::.:|||.  ....|.::...|....:||.:|      
  Fly  1407 VNENATDRERTNFLSEASVMKEFDTYHVVRLLGVC--SRGQPALVVMELMKKGDLKSYLRAHRPE 1469

  Fly   406 -LDPACARTVTTI------------QIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVK 457
             .|.|....:..|            :|..||.:::..:.:|.:...||:|:|.|||::.|.|.||
  Fly  1470 ERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVK 1534

  Fly   458 LSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAE 522
            :.|..::||::.:||...|.....||:||..|:|:...:|.|||.::|||::||:.|.|.|||..
  Fly  1535 IGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQG 1599

  Fly   523 VDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQL-----QSCLSEFYSQITR 582
            :...::..|:.||..:.:|.||||.|..:|..||....:.||:|..:     ..|.:..:.:::.
  Fly  1600 LSNEQVLRYVIDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSF 1664

  Fly   583 Y 583
            |
  Fly  1665 Y 1665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745 26/148 (18%)
PKc_like 310..580 CDD:304357 82/299 (27%)
Pkinase_Tyr 317..573 CDD:285015 80/285 (28%)
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020 14/82 (17%)
PTKc_InsR_like 1364..1652 CDD:173625 83/299 (28%)
Pkinase_Tyr 1371..1650 CDD:285015 82/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.