DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and htl

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:139/283 - (49%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQDVLVKTVAQHASQMQVLLLLQ--EGMLLYGAS 370
            |...:.|..:.|.:.|.||.||||.....|:. .|.||.|.:..:...:..|::  |.|.:.| .
  Fly   407 SNWELPRSHLVLGATLGEGAFGRVVMAEVNNA-IVAVKMVKEGHTDDDIASLVREMEVMKIIG-R 469

  Fly   371 HPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLL------------------DPACARTVTTI 417
            |..|:::||...::.....::..|.:.  |||.||.                  .|. |..:|..
  Fly   470 HINIINLLGCCSQNGPLYVIVEYAPHG--NLKDFLYKNRPFGRDQDRDSSQPPPSPP-AHVITEK 531

  Fly   418 QIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRP 482
            .::..|.|::..:|:|.|...:|:|:|.||.::.|...:|::|..|:||:..:||.....:...|
  Fly   532 DLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLP 596

  Fly   483 VKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEV-DPFEMEHYLKDGYRLAQPFNCPD 546
            :|||:.|:||.|.:...||.|::|:|:||:.|..:|||..: ...|:..||..|.|:.:|..|..
  Fly   597 IKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSM 661

  Fly   547 ELFTIMAYCWALLPAERPTFAQL 569
            .::.:|..||.....:||.|.::
  Fly   662 NIYILMRQCWHFNADDRPPFTEI 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 81/281 (29%)
Pkinase_Tyr 317..573 CDD:285015 80/274 (29%)
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 82/283 (29%)
STYKc 416..688 CDD:214568 80/274 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.