DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and Ror

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:480 Identity:124/480 - (25%)
Similarity:223/480 - (46%) Gaps:73/480 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVTHLVFRRKKICLMND 184
            |...|||.||:   ....||..:|         :::...|::......|...:  .....|.::.
  Fly   246 RGVANVSASGK---PCLRWSWLMK---------EISDFPELIGQNYCRNPGSV--ENSPWCFVDS 296

  Fly   185 SAEDLSEDVDDPQLLETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQP 249
            |.|.:.|..|.|:..:.:.:       .:||.:.|   :.|:.:|.:.:  ...||:...|.|  
  Fly   297 SRERIIELCDIPKCADKIWI-------AIVGTTAA---IILIFIIIFAI--ILFKRRTIMHYG-- 347

  Fly   250 MRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSS---------------LPRKVPVSVEQQH 299
            ||  :...:|               |||....|:|:|               |...|.::.:...
  Fly   348 MR--NIHNIN---------------TPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIE 395

  Fly   300 PEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTY----NDTQDVLVKTVAQHASQMQVLLLL 360
            ...| .||:..|::  .|.....|.||.||:||:|..    ..|..|.:|.:.::||........
  Fly   396 RNTL-LRINHFTLQ--DVEFLEELGEGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFK 457

  Fly   361 QEGMLLYGASHPGILSVLGVSIEDHTTPF-VLYPALNNTRNLKQFLL--DPACARTVTTIQIVMM 422
            :|..|:....|..|:.:|||.:  :..|: :|:..:.| .:|.:||:  .|...::::.::.:.:
  Fly   458 REIELISDLKHQNIVCILGVVL--NKEPYCMLFEYMAN-GDLHEFLISNSPTEGKSLSQLEFLQI 519

  Fly   423 ASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRPVKWMS 487
            |.|:|..:.:|.:|..||:|:|.|||::::.|.||:||..||||::.|||..:......||:||.
  Fly   520 ALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMP 584

  Fly   488 LEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIM 552
            .|::.:.:|:..||.|:|||::||:.:...|||......|:.:.::....|:.|.|||..::::|
  Fly   585 SESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQLLSAPENCPTAVYSLM 649

  Fly   553 AYCWALLPAERPTFAQLQSCLSEFY 577
            ..||.....:||||..:.:.|..::
  Fly   650 IECWHEQSVKRPTFTDISNRLKTWH 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745 12/61 (20%)
PKc_like 310..580 CDD:304357 84/275 (31%)
Pkinase_Tyr 317..573 CDD:285015 82/262 (31%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527 17/79 (22%)
PTKc_Ror 404..673 CDD:270642 84/273 (31%)
Pkinase_Tyr 410..670 CDD:285015 82/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.