DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and Ddr

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster


Alignment Length:355 Identity:90/355 - (25%)
Similarity:155/355 - (43%) Gaps:66/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PPCQSSMGSAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVER--CRV----RLS 320
            ||...|.||.:..|.:...|..|     .|.|.....:..::....:::..||  |:|    |.|
  Fly   699 PPGSQSSGSLSSSTTAATTPTSG-----VVGVGKPHHYNLDMSANFADINEERANCQVQEFPRQS 758

  Fly   321 SLLQE----GTFGRVY---RGTYNDT-----------QDVLVKTVAQHASQMQVLLLLQEGMLLY 367
            .::.|    |.||.::   ....|.|           .|.|.|.....|.|:..|          
  Fly   759 LVIVEKLGSGVFGELHLCETNVLNATLVAVATLRPGANDHLRKEFRSKAKQLAQL---------- 813

  Fly   368 GASHPGILSVLGVSIEDHTTPFVLYPALNN-TRNLKQFLLDPA-------CARTVTTIQIVMMAS 424
              |.|.:..::|..:.|.  |..:....:: ..:|.|||.:..       ..::::...:|.:|:
  Fly   814 --SDPNVARLVGACLRDE--PICIVQDYSHCLGDLNQFLQEHVAETSGLMAKKSLSFGCLVYIAT 874

  Fly   425 QLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSD--SSLSRDLFPSDYNCL-----GDSENRP 482
            |::..:.||.....||:|:|||:|:|..:|.||:..  :.::|..:.|||..|     ..|:..|
  Fly   875 QIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMP 939

  Fly   483 VKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAK-QPYAEVDPFEMEHYLKDGYR-------LA 539
            ::||:.|::...:|:..||.|:|.|.:||:.|.|: |||..:....:...:...||       |.
  Fly   940 IRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLP 1004

  Fly   540 QPFNCPDELFTIMAYCWALLPAERPTFAQL 569
            .|.|||.|::.:|..||....:.||:|.::
  Fly  1005 MPPNCPREIYDLMCECWQRDESSRPSFREI 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 80/307 (26%)
Pkinase_Tyr 317..573 CDD:285015 77/298 (26%)
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 76/296 (26%)
TyrKc 759..1038 CDD:197581 74/290 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.