DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and wis4

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_593557.1 Gene:wis4 / 2542873 PomBaseID:SPAC9G1.02 Length:1401 Species:Schizosaccharomyces pombe


Alignment Length:452 Identity:95/452 - (21%)
Similarity:156/452 - (34%) Gaps:145/452 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VDDPQLLETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQR 257
            :||...|:         |...||.|:|      .|:..:.|.||.:|           ..:..||
pombe   919 IDDAMFLK---------IREKVGKSMA------FLLTHFDVLGAKSK-----------VAAKLQR 957

  Fly   258 LNTH---PPCQSSMGSAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRL 319
            .:|.   .|..:|.|.......||                  |...:|...||.||.:||....|
pombe   958 ESTEVSSSPRLTSFGDVEEEALSI------------------QLLQKETMLRIDELEIERNNTLL 1004

  Fly   320 SSL-----------------------------------LQEGTFGRVYRGTYNDTQDVLV----- 344
            ..|                                   ::.|.||.||.|...:|.|:|.     
pombe  1005 ERLAIGHVLDDSVFRNRDFIKLASSFSNITIRWQQGHFVRSGMFGDVYTGVNMETGDLLAVKEIK 1069

  Fly   345 --------KTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNL 401
                    .||.|..::|.||..|         :||.:::..||.:  |.....::.......:|
pombe  1070 LQDSRTFRSTVDQIHNEMTVLERL---------NHPNVVTYYGVEV--HREKVYIFMEFCQGGSL 1123

  Fly   402 KQFLLDPACARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRD 466
            ...|   |..|......:.:...||...|.::||..::|:||...|.::|.:..:|.||...:..
pombe  1124 ADLL---AHGRIEDENVLKVYVVQLLEGLAYIHSQHILHRDIKPANILLDHRGMIKYSDFGSALY 1185

  Fly   467 LFPSDYNCLGDSENRPVKWMSLE-ALQH-----------------KQFSEASDSWAFGVLMWELC 513
            :.|..     |.|   |::..:: .|||                 |....|.|.|:.|.::.|:.
pombe  1186 VSPPT-----DPE---VRYEDIQPELQHLAGTPMYMAPEIILGTKKGDFGAMDIWSLGCVILEMM 1242

  Fly   514 TSAKQPYAEVD-PFEMEHYLKDGYRLAQPFNCPDELFTIMA-----YCWALLPAERPTFAQL 569
            |.: .|::|:| .:.:.:::...:..:.|.|   |..:.:|     .|:...|.:||....|
pombe  1243 TGS-TPWSEMDNEWAIMYHVAAMHTPSIPQN---EKISSLARDFIEQCFERDPEQRPRAVDL 1300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 69/332 (21%)
Pkinase_Tyr 317..573 CDD:285015 66/325 (20%)
wis4NP_593557.1 STKc_MEKK4 1036..1306 CDD:270796 64/291 (22%)
S_TKc 1037..1306 CDD:214567 64/290 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.