DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and ERBB4

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_016859066.1 Gene:ERBB4 / 2066 HGNCID:3432 Length:1349 Species:Homo sapiens


Alignment Length:310 Identity:81/310 - (26%)
Similarity:141/310 - (45%) Gaps:38/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 PVSVEQQHPEELHRRI-SELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQD-----VLVKTVAQH 350
            |::.....|.:...|| .|..::|.:|     |..|.||.||:|.:....:     |.:|.:.:.
Human   738 PLTPSGTAPNQAQLRILKETELKRVKV-----LGSGAFGTVYKGIWVPEGETVKIPVAIKILNET 797

  Fly   351 ASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPAC----- 410
            ......:..:.|.:::....||.::.:|||             .|:.|..|...|:...|     
Human   798 TGPKANVEFMDEALIMASMDHPHLVRLLGV-------------CLSPTIQLVTQLMPHGCLLEYV 849

  Fly   411 ---ARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSD- 471
               ...:.:..::....|::..:.:|....:||:|:|.||.::.....||::|..|:| |...| 
Human   850 HEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLAR-LLEGDE 913

  Fly   472 --YNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKD 534
              ||  .|....|:|||:||.:.:::|:..||.|::||.:|||.|...:||..:...|:...|:.
Human   914 KEYN--ADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEK 976

  Fly   535 GYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQITRYV 584
            |.||.||..|..:::.:|..||.:....||.|.:|.:..|.......||:
Human   977 GERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYL 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 74/285 (26%)
Pkinase_Tyr 317..573 CDD:285015 72/271 (27%)
ERBB4XP_016859066.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.