DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and ERBB2

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_024306409.1 Gene:ERBB2 / 2064 HGNCID:3430 Length:1301 Species:Homo sapiens


Alignment Length:410 Identity:106/410 - (25%)
Similarity:175/410 - (42%) Gaps:75/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DVDDPQL-LETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSF 255
            |:||... .|....|.|.:|:.|||:        ||:::...|.|...||:.     |.:|..:.
Human   682 DLDDKGCPAEQRASPLTSIISAVVGI--------LLVVVLGVVFGILIKRRQ-----QKIRKYTM 733

  Fly   256 QRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRLS 320
            :||              .....::.|:..|.           ..|.:...||    ::...:|..
Human   734 RRL--------------LQETELVEPLTPSG-----------AMPNQAQMRI----LKETELRKV 769

  Fly   321 SLLQEGTFGRVYRGTY-----NDTQDVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGV 380
            .:|..|.||.||:|.:     |....|.:|.:.::.|......:|.|..::.|...|.:..:||:
Human   770 KVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGI 834

  Fly   381 ---SIEDHTTPFVLYPAL------NNTRNLKQFLLDPACARTVTTIQIVMMASQLSMALDHLHSH 436
               |.....|..:.|..|      |..|...|.||:              ...|::..:.:|...
Human   835 CLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLN--------------WCMQIAKGMSYLEDV 885

  Fly   437 GVVHKDIATRNCVIDDQLRVKLSDSSLSR--DLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEA 499
            .:||:|:|.||.::.....||::|..|:|  |:..::|:  .|....|:|||:||::..::|:..
Human   886 RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYH--ADGGKVPIKWMALESILRRRFTHQ 948

  Fly   500 SDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERP 564
            ||.|::||.:|||.|...:||..:...|:...|:.|.||.||..|..:::.||..||.:....||
Human   949 SDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRP 1013

  Fly   565 TFAQLQSCLSEFYSQITRYV 584
            .|.:|.|..|.......|:|
Human  1014 RFRELVSEFSRMARDPQRFV 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 79/285 (28%)
Pkinase_Tyr 317..573 CDD:285015 78/271 (29%)
ERBB2XP_024306409.1 Recep_L_domain 52..173 CDD:307256
Furin-like 189..384 CDD:307072
Recep_L_domain 412..532 CDD:307256
GF_recep_IV 557..689 CDD:317276 3/6 (50%)
TM_ErbB2 687..730 CDD:213055 14/55 (25%)
PTKc_HER2 758..1036 CDD:270684 83/296 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.