DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and Erbb2

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001003817.1 Gene:Erbb2 / 13866 MGIID:95410 Length:1256 Species:Mus musculus


Alignment Length:413 Identity:100/413 - (24%)
Similarity:163/413 - (39%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMG 269
            |.|.:|..||||        ||.:|...|.|...||:.     |.:|..:.:||           
Mouse   651 PVTFIIATVVGV--------LLFLIIVVVIGILIKRRR-----QKIRKYTMRRL----------- 691

  Fly   270 SAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRG 334
               .....::.|:..|...           |.:...||    ::...:|...:|..|.||.||:|
Mouse   692 ---LQETELVEPLTPSGAV-----------PNQAQMRI----LKETELRKLKVLGSGAFGTVYKG 738

  Fly   335 TY-----NDTQDVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPA 394
            .:     |....|.:|.:.::.|......:|.|..::.|...|.:..:||:.:            
Mouse   739 IWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICL------------ 791

  Fly   395 LNNTRNLKQFLLDPACARTVTTIQIVMMASQLSMALDHLHSH----------------------- 436
                               .:|:|:|.........|||:..|                       
Mouse   792 -------------------TSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYL 837

  Fly   437 ---GVVHKDIATRNCVIDDQLRVKLSDSSLSR--DLFPSDYNCLGDSENRPVKWMSLEALQHKQF 496
               .:||:|:|.||.::.....||::|..|:|  |:..::|:  .|....|:|||:||::..::|
Mouse   838 EEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYH--ADGGKVPIKWMALESILRRRF 900

  Fly   497 SEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPA 561
            :..||.|::||.:|||.|...:||..:...|:...|:.|.||.||..|..:::.||..||.:...
Mouse   901 THQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSE 965

  Fly   562 ERPTFAQLQSCLSEFYSQITRYV 584
            .||.|.:|.|..|.......|:|
Mouse   966 CRPRFRELVSEFSRMARDPQRFV 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 75/302 (25%)
Pkinase_Tyr 317..573 CDD:285015 74/288 (26%)
Erbb2NP_001003817.1 Recep_L_domain 52..174 CDD:279382
Furin-like 190..339 CDD:279142
FU 236..281 CDD:238021
Recep_L_domain 367..487 CDD:279382
GF_recep_IV 511..644 CDD:291509
FU 512..>545 CDD:238021
FU 558..604 CDD:214589
TM_ErbB2 642..685 CDD:213055 15/46 (33%)
Nuclear localization signal. /evidence=ECO:0000250 677..690 4/17 (24%)
Required for interaction with KPNB1 and EEA1. /evidence=ECO:0000250 677..690 4/17 (24%)
PTKc_HER2 713..991 CDD:270684 79/313 (25%)
Pkinase_Tyr 721..977 CDD:285015 74/288 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1030..1180
Interaction with PIK3C2B. /evidence=ECO:0000250 1196..1198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1200..1219
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1224..1256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.