DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and WIF1

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_009122.2 Gene:WIF1 / 11197 HGNCID:18081 Length:379 Species:Homo sapiens


Alignment Length:158 Identity:39/158 - (24%)
Similarity:73/158 - (46%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MWVLS-LLALAALQLHSGSEVAAHLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNF------ 81
            :|:.| ||.|.||:..:|......|.::::..:...|:|...::..|.||.:..:..:|      
Human    12 LWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQR 76

  Fly    82 IVPVPANVKDISFTWQSLAGRGLPYS-INVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKC- 144
            :..:|.|:..::||||:.......|. :::.|.|:.::..|.:||...|.:|.......:...| 
Human    77 MPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCL 141

  Fly   145 ---SGLKAAEVDVTVSLEVVLNRSLNNV 169
               .|:.|.||||     :|:|...|.:
Human   142 GKQDGVAAFEVDV-----IVMNSEGNTI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745 31/135 (23%)
PKc_like 310..580 CDD:304357
Pkinase_Tyr 317..573 CDD:285015
WIF1NP_009122.2 WIF 35..179 CDD:128745 31/135 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.