DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnt and si:ch73-383l1.1

DIOPT Version :9

Sequence 1:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_021331611.1 Gene:si:ch73-383l1.1 / 101885162 ZFINID:ZDB-GENE-121214-64 Length:1392 Species:Danio rerio


Alignment Length:324 Identity:81/324 - (25%)
Similarity:137/324 - (42%) Gaps:66/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 PVSVEQQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQD-----VLVKTVAQHA 351
            |::.....|.:...||.:.| |..||:   :|..|.||.||:|.:....:     |.:|.:.:..
Zfish   686 PLTPSGTAPNQAQLRILKET-ELKRVK---ILGTGAFGTVYKGIWVPEGETVKIPVAIKILNEST 746

  Fly   352 SQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACARTVTT 416
            .....:..:.|.:::....||.::.:|||                        .|.|       |
Zfish   747 GPKANVEFMDEALIMASMEHPHLVRLLGV------------------------CLSP-------T 780

  Fly   417 IQIVMMASQLSMALDHLHSH--------------------------GVVHKDIATRNCVIDDQLR 455
            ||:|.........||::|.|                          .:||:|:|.||.::.....
Zfish   781 IQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNH 845

  Fly   456 VKLSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPY 520
            :|::|..|:|.|..::.....|....|:|||:||.:.:::|:..||.|::||.:|||.|...:||
Zfish   846 IKITDFGLARLLETNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPY 910

  Fly   521 AEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQITRYV 584
            ..:...|:...|:.|.||.||..|..:::.:|..||.:....||.|.:|.:..|.......||:
Zfish   911 DGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYL 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dntNP_001260567.1 WIF 46..182 CDD:128745
PKc_like 310..580 CDD:304357 75/300 (25%)
Pkinase_Tyr 317..573 CDD:285015 71/286 (25%)
si:ch73-383l1.1XP_021331611.1 Recep_L_domain 54..166 CDD:307256
Furin-like 183..331 CDD:307072
Recep_L_domain 357..477 CDD:307256
GF_recep_IV 501..633 CDD:317276
TM_ErbB4 631..674 CDD:213053
PKc_like 699..995 CDD:328722 79/311 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.