DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10750 and Cfap73

DIOPT Version :9

Sequence 1:NP_001286084.1 Gene:CG10750 / 35206 FlyBaseID:FBgn0032769 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001182023.1 Gene:Cfap73 / 546886 MGIID:3779542 Length:306 Species:Mus musculus


Alignment Length:287 Identity:71/287 - (24%)
Similarity:139/287 - (48%) Gaps:14/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VKPPNWDSAGDNIEML-YIANLREYDAMKQVQIQLLKDAKRQAALNV-QRIRKMYKIQERLRKRF 100
            |:|...:..||:..:| .|...:|..|:..:.:|..|...|....:| ||.|::.:..:.|:...
Mouse    17 VQPKPLEQTGDDSSVLQLILEKKEELAVADLGLQAQKKEYRSTIESVNQRWRELEQKGQELQGSV 81

  Fly   101 VEVNGFIKDCADKKRSADKSIREETVLHAEVTKEIDEFKTSIAELSTFRNALKATVAQFQPYERV 165
            :..:.|:|: .:.:|:|.|:| ||..:...:..|:...:|.:.||...|..|:..|.:.:|..|:
Mouse    82 ISYDKFLKE-VEARRAARKAI-EERKITGNLDAELRRLRTQLKELRLQRARLQRKVQRLEPCARI 144

  Fly   166 LEEVVEVSDIFISTKDCIDRCDALMLAQVEINKLESQK-LNEIEEMRLRMVQITSEAALTVLGLK 229
            |:..:|...:|....|.:.|.:.|:..:..: |||.|| |.|:|..|.:::.:.||....:|.|.
Mouse   145 LKRALEKRPVFEEVSDLVARFETLVSTKAAL-KLEEQKRLVEMESTRAQLLSLQSEKQDEMLNLN 208

  Fly   230 NDLARLDRSYVSSRATCLKWE----KILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRGIVPS 290
            ....:|.....::|....:||    :||::..:.|.|  |.:.||  .:..||.::..::|...:
Mouse   209 QQRTQLVEQLEAAREHRQQWESKWTEILNSASEKTLL--LGRARM--AVLNLYHLVRLQQGRRQT 269

  Fly   291 YHSYEIDKIMSFIMREISLLSSVLQEL 317
            ....:::..:..:.|.|..:|:.|.:|
Mouse   270 LDVRDVEGQLEEVKRFIMNISATLAKL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10750NP_001286084.1 DUF4200 54..165 CDD:290574 27/111 (24%)
Cfap73NP_001182023.1 DUF4200 36..151 CDD:290574 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JKH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5292
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56442
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21683
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.