DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10750 and Cfap73

DIOPT Version :9

Sequence 1:NP_001286084.1 Gene:CG10750 / 35206 FlyBaseID:FBgn0032769 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_222198.5 Gene:Cfap73 / 304509 RGDID:1561303 Length:305 Species:Rattus norvegicus


Alignment Length:276 Identity:64/276 - (23%)
Similarity:123/276 - (44%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IQLLKDAKRQAAL---NVQRIRKMYK-IQERLRKRFVEVNGFIKDCADK----KRSA---DKSIR 122
            :||:.:.|::.|:   .:|..||.:: ..|.:.:|::|:       |.|    |.||   || :|
  Rat    29 LQLILEKKQEVAVTDQGLQAQRKEFRSTMESVNQRWIEL-------AQKGQALKGSAIYFDK-LR 85

  Fly   123 EETVLHAEVTKEIDE-------------FKTSIAELSTFRNALKATVAQFQPYERVLEEVVEVSD 174
            :|....:||.|.|.|             .:..:.||...|..|:..|.:.:|..::||.|.:...
  Rat    86 KEAEARSEVWKAIQERHRMHNLEADVLRLRAQLKELQLQRERLQRRVQRLEPCAQILEGVRKQLP 150

  Fly   175 IFISTKDCIDRCDALMLAQVEINKLESQKLNEIEEMRLRMVQITSEAALTVLGLKNDLARLDRSY 239
            .|....|.:.|...|:..:..:...|:.:..|:|..|.|::::.....:.:|.|..:..||....
  Rat   151 QFQEVLDMVARFQVLVDTKAVLKLAETDRHVEVEATRARLLRLREAKQVELLRLNQERIRLCEQL 215

  Fly   240 VSSRATC----LKWEKILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRGIVPSYHSYEI---- 296
            .::|...    .||.:|.:...:.:.|  |.:.||  .:..||:::|.::|........:|    
  Rat   216 EAARELTQQRESKWTEIQNKASEKSLL--LGRTRM--AVLNLYQLVCMKQGQKQILDMEDIEGQL 276

  Fly   297 DKIMSFIMREISLLSS 312
            :::..|||...::|:|
  Rat   277 EEVKQFIMSVSAILAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10750NP_001286084.1 DUF4200 54..165 CDD:290574 30/119 (25%)
Cfap73XP_222198.5 DUF4200 33..148 CDD:290574 31/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56442
OrthoDB 1 1.010 - - D1528754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21683
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.