DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10750 and Ccdc42

DIOPT Version :9

Sequence 1:NP_001286084.1 Gene:CG10750 / 35206 FlyBaseID:FBgn0032769 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001100479.1 Gene:Ccdc42 / 303234 RGDID:1565925 Length:316 Species:Rattus norvegicus


Alignment Length:293 Identity:62/293 - (21%)
Similarity:123/293 - (41%) Gaps:13/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QFFVKPPNWDSAGDNIEMLYIANLREYDAMKQVQIQLLKDA--KRQAALNVQRIRKMYKIQERLR 97
            |...|.||.:...|:..:..:...:|...|::. ::..|:.  :|...||: |..::...:|:|:
  Rat    25 QLLQKFPNVEEQSDSPSIRLLEKKKEAKVMQEA-MEHKKETFQRRMETLNL-RWEELGIKEEQLK 87

  Fly    98 KRFVEVNGFIKDCADKKRSADKSIREETVLHAEVTKEIDEFKTSIAELSTFRNALKATVAQFQPY 162
            ....:...||::...|:..|.|...:|..|..:..:|:.:.|..:..|......|...:..:..:
  Rat    88 AHIQKFEQFIQENDQKRIRALKKANKERELKRQRLRELAKAKQEMTALRLEHQKLSVKLQDYAIF 152

  Fly   163 ERVLEEVVEVSDIFISTKDCIDRCDALMLAQVEINKLESQKLNEIEEMRLRMVQITSEAALTVLG 227
            .:.||:|||.|: |....:.|.|...|:....::.:...:...:||..:.|:.:...|....:|.
  Rat   153 NKYLEKVVENSE-FEEIHEVIARYKTLVSMHHDLMQSAQEGQEKIEHAKARLARYMEEKDDEILQ 216

  Fly   228 LKNDLARLDRSYVSSRATCLKWEK----ILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRGIV 288
            ..|:||||...:..:|:..:.||.    |.:.....|.|....|....:..||:.:.|.:...:.
  Rat   217 HNNELARLQMRFDRARSDVIFWESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKQLKESTQVS 281

  Fly   289 PSYHSYEIDKIMSFIMREISLLSSVLQELESNK 321
            ......::|.|..||..    ||.:..|::..:
  Rat   282 LEDTHKQLDMIQQFIQD----LSDIWTEVKKKE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10750NP_001286084.1 DUF4200 54..165 CDD:290574 20/112 (18%)
Ccdc42NP_001100479.1 DUF4200 44..162 CDD:404704 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JKH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56442
OrthoDB 1 1.010 - - D1528754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104323
Panther 1 1.100 - - LDO PTHR21683
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.