DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10750 and CCDC42

DIOPT Version :9

Sequence 1:NP_001286084.1 Gene:CG10750 / 35206 FlyBaseID:FBgn0032769 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_653282.2 Gene:CCDC42 / 146849 HGNCID:26528 Length:316 Species:Homo sapiens


Alignment Length:296 Identity:64/296 - (21%)
Similarity:125/296 - (42%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QFFVKPPNWDSAGDNIEMLYIANLREYDAMKQVQIQLLK-DAKRQAALNVQRIRKMYKIQERLRK 98
            |...|.||.:.|.::..:..:...:|.:.|.|..:|..| ..:|...||: |..::...:.:|:.
Human    25 QMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNL-RWEELGVKEAQLKA 88

  Fly    99 RFVEVNGFIKDCADKKRSADKSIREETVLHAEVTKEIDEFKTSIAELSTFRNALKATVAQFQPYE 163
            ...:...||::...|:..|.|...:|..|..:..:|:.:.|..:..|......|.|.:..:..:.
Human    89 HIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFN 153

  Fly   164 RVLEEVVEVSDIFISTKDCIDRCDALMLAQVEINKLESQKLNEIEEMRLRMVQITSEAALTVLGL 228
            :.||:|||.|: |....:.|.|...|:..:.::.:...:...:||..:.|:.:...|....:|..
Human   154 KYLEKVVENSE-FEEIHEVIARYKTLVSMRHDLMQSAQEGQEKIERAKARLARYMEEKDDEILQQ 217

  Fly   229 KNDLARLDRSYVSSRATCLKWEK----ILSACKDTTSLYNLDKERMFDGIQILYRMLCKRRGIVP 289
            .|:||||...:..:|:..:.||.    |.:.....|.|....|....:..||:.:.|.:...:..
Human   218 NNELARLQMRFDRARSNVIFWESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVAL 282

  Fly   290 SYHSYEIDKIMSFIMREISLLSSVLQELESNKGDKV 325
            .....::|.|..||...    |.:..|::..:..:|
Human   283 EDTHKQLDMIQQFIQDR----SDIWAEVKKKEQQRV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10750NP_001286084.1 DUF4200 54..165 CDD:290574 22/111 (20%)
CCDC42NP_653282.2 DUF4200 44..162 CDD:290574 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JKH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5381
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56442
OrthoDB 1 1.010 - - D1528754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104323
Panther 1 1.100 - - LDO PTHR21683
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.