DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTub37C and Y19D2B.1

DIOPT Version :9

Sequence 1:NP_001260565.1 Gene:gammaTub37C / 35199 FlyBaseID:FBgn0010097 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_496352.1 Gene:Y19D2B.1 / 189479 WormBaseID:WBGene00012489 Length:85 Species:Caenorhabditis elegans


Alignment Length:92 Identity:21/92 - (22%)
Similarity:41/92 - (44%) Gaps:24/92 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTGISSLFKRALAQYDKLRKRNAFLDNFR 410
            :.:|||:                   |.|  .|:::.|.|:..:.|...::|.:..:.||:..:.
 Worm     1 MVSFIPF-------------------HNV--CMLSDTTAIAEAWSRLDYKFDLMYAKRAFVHWYV 44

  Fly   411 RESMFQDDLTELDIARDTVDCLVQEYE 437
            .|.|.:.:.||   ||:.:..|.::||
 Worm    45 GEGMEEGEFTE---AREDLAALEKDYE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTub37CNP_001260565.1 PLN00222 1..447 CDD:215108 21/92 (23%)
gamma_tubulin 4..436 CDD:276957 19/89 (21%)
Y19D2B.1NP_496352.1 Tubulin_FtsZ_Cetz-like <9..70 CDD:299146 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.