DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTub37C and CG32396

DIOPT Version :9

Sequence 1:NP_001260565.1 Gene:gammaTub37C / 35199 FlyBaseID:FBgn0010097 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_729172.1 Gene:CG32396 / 117406 FlyBaseID:FBgn0052396 Length:462 Species:Drosophila melanogaster


Alignment Length:456 Identity:142/456 - (31%)
Similarity:239/456 - (52%) Gaps:50/456 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIITLQLGQCGNQIGFEFWKRLCLEHGISPDGVLEDFATDGQ---------DRKDVFFYQADDNH 59
            ||:|||:|..||.||..||..:..|||:       |:|: |:         :|.:|||.......
  Fly     3 EIVTLQIGGAGNAIGDSFWHVISHEHGV-------DYAS-GRFGGTSPLQLERINVFFNATASKR 59

  Fly    60 YIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASGF-SQGEKVQEEVFDILD 123
            :..|.:|||.|...|..:..|  |:||..||......  .||||:|.|: :.|..:.::|.:...
  Fly    60 FYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSE--SAGNNFARGYHTDGAAILDQVLENTR 120

  Fly   124 READGSDSLEGFVLCHSIAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDVVVQPYNS 188
            ||.:..|||:||.|.|||.||||||:.|.::|.|.|::|..|:..|...|:.: :|.|||:|||:
  Fly   121 REVESVDSLQGFQLLHSIGGGTGSGLTSLIMEALVEQYPDNLLCNYVTIPSPN-MSQVVVEPYNA 184

  Fly   189 ILTLKRLTKCADSVVVLDNTALNRIATERLHIQTPTFTQINNLVSTIMSLSTTTLRYPSYMNNNL 253
            :|:...|...:.....|||.||.:|....|.::...:..||::|:..||..||.||:|..:|..|
  Fly   185 LLSTPALVNNSHLTFCLDNEALFQICNRNLKLKMSGYEHINHIVALTMSGITTCLRFPGQLNAGL 249

  Fly   254 IGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLLQPKNMMVSALTDKQSRQCF 318
            ..:..:::|.|:||||:.|:.||:: |: :....|.||.::::::....|:: .|:..::.:  .
  Fly   250 RKIYVNMVPFPRLHFLIPGFAPLVT-CK-QQQFSKGTVSELVQQIFYSNNLL-CAIDLRKGK--L 309

  Fly   319 VSILNIIQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVAL----PRSSPYVQSAHKVSGLMM 379
            ::...|.:|.:.|.:|.:.:..:|.:.:.||:.|.|.:|:.|:    ||..       |:|...:
  Fly   310 LTAAGIFRGRMSPREVDQLMTGVRNKNINNFVDWIPNNIKTAICDIPPRGL-------KMSATFI 367

  Fly   380 ANHTGISSLFKRALAQYDKLRKRNAFLDNFRRESM----FQDDLTELDIARDTVDCLVQEYEAAT 440
            .|.|.|.:||:|.|.....:.:|.|.|..:..|.|    |||       |:..:..::.:|.::.
  Fly   368 GNTTAIQTLFQRLLDASMSMLRRKAHLHWYTGEGMEEQEFQD-------AQQELQAIIDDYRSSA 425

  Fly   441 Q 441
            :
  Fly   426 E 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTub37CNP_001260565.1 PLN00222 1..447 CDD:215108 142/456 (31%)
gamma_tubulin 4..436 CDD:276957 141/449 (31%)
CG32396NP_729172.1 PTZ00010 1..421 CDD:240228 141/449 (31%)
beta_tubulin 2..425 CDD:276956 142/453 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11588
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.