DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and AZF1

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:90/391 - (23%)
Similarity:153/391 - (39%) Gaps:82/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDELPQEELSQPRL 215
            :.:..|:..|:|            .||.||...|.......| |:.|::::...| ::.|:..  
Yeast   383 NNDNSINSATST------------NIPNQEDHSLASTDTTSN-SRKDLKEIEQRL-RKHLNDE-- 431

  Fly   216 DSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLV-------AVATTPNTLESTAEEKAKRG 273
            |:.:|..|...| |:::::..||.:..:...|...:::       :.....|.:..|....:|..
Yeast   432 DNYSSAISRPLD-KNDVIEGSEGLNKHIDESGMQPNIIKKRKKDDSTVYVKNEMPRTDPPMSKDN 495

  Fly   274 RMDCEKCGKVYRNRASYE------KHLERECRRIERRVKVD---------------KTTTTCD-- 315
            ....|  |....|.:..|      ..:..:...:....|||               |..||.|  
Yeast   496 STSAE--GAAMANFSGKEPPIPDISSVSDDATNLIGATKVDQLMLIIQARKKGFTEKVNTTQDGD 558

  Fly   316 -ICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFK 379
             :.|:|:.   .|....|.:....||       |..:...|:.:|          ||..|...|.
Yeast   559 LLFNQTMD---ILPPKSELVGGVEKP-------KGTQNTRAVKKH----------ECPYCHRLFS 603

  Fly   380 NRARLKAHYQIHA--EPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTH 442
            ....|:.|.:.|.  :| |||:.|||:.........|:.:||.|:...||:|...|.|...|..|
Yeast   604 QATHLEVHVRSHIGYKP-FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAH 667

  Fly   443 LLSHTGLRPYVCNY--CGKSFACNANCRSHKLKKHPQEVQQEDGARL----PSRLNVPTLDELRV 501
            |::|..|:|:||..  |.|:|....|.::|:.:.| :|......|:|    ||. |:| |:|.::
Yeast   668 LVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH-KETLNALTAKLAEMNPSE-NIP-LEERQL 729

  Fly   502 M 502
            :
Yeast   730 L 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 46/164 (28%)
C2H2 Zn finger 314..335 CDD:275368 5/23 (22%)
C2H2 Zn finger 343..363 CDD:275368 3/19 (16%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 439..463 CDD:290200 11/25 (44%)
C2H2 Zn finger 454..475 CDD:275368 6/22 (27%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 90/391 (23%)
C2H2 Zn finger 595..615 CDD:275368 5/19 (26%)
C2H2 Zn finger 623..643 CDD:275368 5/19 (26%)
C2H2 Zn finger 651..671 CDD:275368 8/19 (42%)
C2H2 Zn finger 679..702 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.