DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and STP4

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:431 Identity:80/431 - (18%)
Similarity:130/431 - (30%) Gaps:147/431 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDEL 205
            |...||:..||..:.:...::.|:||        .:.::||......|....||.:. ..|||. 
Yeast   117 LSPTPLSSNSSSHVILPPISSFTNLI--------TVAEREFNGRSNSLHANFTSPVP-RTVLDH- 171

  Fly   206 PQEEL----------------SQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDG------- 247
            .:.||                |.|....:..|.:::|..:|:.:.|       |||.|       
Yeast   172 HRHELTFCNPNNTTGFKTITPSPPTQHQSILPTAVDNVPRSKSVSS-------LPVSGFPPLIVK 229

  Fly   248 -----QLMDLVAVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKV 307
                 ||....:.:..|:.......|...|.....:...|:.:.|...|                
Yeast   230 QQQQQQLNSSSSASALPSIHSPLTNEHTSRYSSSLKDSAKITKQRKKKE---------------- 278

  Fly   308 DKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVH--TESRPFE 370
                  |.||:...::                                |:.||..|  .|.||.:
Yeast   279 ------CPICHNFYAN--------------------------------LSTHKSTHLTPEDRPHK 305

  Fly   371 CTVCKAGFKNRARLKAHYQIHAEPSFV-------CNICGKKLQ--TRRT---------------- 410
            |.:|:.||.....|..|.:.|.:..|:       .|..|...|  |.||                
Yeast   306 CPICQRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGADDQDDTARTSANNDSDDSNDKLAAS 370

  Fly   411 ----------WNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNA 465
                      .|..|.::..:...||.....|......:..|........|..|:..|....|: 
Yeast   371 SSSEETKLLKKNQLKSLYKIKGAFKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCD- 434

  Fly   466 NCRSHKLK----KHPQEVQQEDGARLPSR-----LNVPTLD 497
            ..::| ||    ::|.:.::||...:|.:     |..|.:|
Yeast   435 TFKNH-LKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVD 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 34/194 (18%)
C2H2 Zn finger 314..335 CDD:275368 3/20 (15%)
C2H2 Zn finger 343..363 CDD:275368 3/19 (16%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 8/47 (17%)
C2H2 Zn finger 426..446 CDD:275368 3/19 (16%)
zf-H2C2_2 439..463 CDD:290200 4/23 (17%)
C2H2 Zn finger 454..475 CDD:275368 6/24 (25%)
STP4NP_010235.1 COG5048 14..442 CDD:227381 72/397 (18%)
C2H2 Zn finger 279..296 CDD:275368 6/48 (13%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.