Sequence 1: | NP_609951.2 | Gene: | CG17568 / 35198 | FlyBaseID: | FBgn0032763 | Length: | 513 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_189580.1 | Gene: | AT3G29340 / 822592 | AraportID: | AT3G29340 | Length: | 650 | Species: | Arabidopsis thaliana |
Alignment Length: | 252 | Identity: | 60/252 - (23%) |
---|---|---|---|
Similarity: | 86/252 - (34%) | Gaps: | 78/252 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 TTTCDICNKTLSSATALK--LHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTV 373
Fly 374 CKAGFKNRARLKAHYQIHAEPS---FVCNICGKKLQTRRTWNMHKVVH---------TEERRLKC 426
Fly 427 DVCGA--------LFKRSKTLK-----------THLLSHTGLRPYV----------------CNY 456
Fly 457 CGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNV-----PTLDELRVMTQKLPK 508 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17568 | NP_609951.2 | zf-AD | 10..87 | CDD:214871 | |
COG5048 | <313..471 | CDD:227381 | 49/206 (24%) | ||
C2H2 Zn finger | 314..335 | CDD:275368 | 5/22 (23%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/38 (18%) | ||
zf-H2C2_2 | 439..463 | CDD:290200 | 12/50 (24%) | ||
C2H2 Zn finger | 454..475 | CDD:275368 | 9/20 (45%) | ||
AT3G29340 | NP_189580.1 | zf-C2H2_6 | 43..68 | CDD:290623 | 10/33 (30%) |
C2H2 Zn finger | 45..65 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 100..120 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |