DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and AT3G29340

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:252 Identity:60/252 - (23%)
Similarity:86/252 - (34%) Gaps:78/252 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 TTTCDICNKTLSSATALK--LHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTV 373
            :|||       |...||:  |..:..|:      |..|||..:...||..|:.:|   ||.:..:
plant    24 STTC-------SGVIALRSNLQSKSSHK------CKICGKSFECYQALGGHQRIH---RPIKEKL 72

  Fly   374 CKAGFKNRARLKAHYQIHAEPS---FVCNICGKKLQTRRTWNMHKVVH---------TEERRLKC 426
            .|..|......|:..|...|.|   :.|.:|||.....|....|..:|         |::.....
plant    73 SKQEFSEVYPRKSKLQKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLL 137

  Fly   427 DVCGA--------LFKRSKTLK-----------THLLSHTGLRPYV----------------CNY 456
            |...|        .||.|:..|           :..|||:|..|..                |..
plant   138 DSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKI 202

  Fly   457 CGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNV-----PTLDELRVMTQKLPK 508
            |||||.|:....:||      .|.:|...:|..:...     |..|.|:  .:|:.|
plant   203 CGKSFVCSQGLGNHK------RVHREISGKLACKRKYTEDYNPFSDSLK--AKKIVK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 49/206 (24%)
C2H2 Zn finger 314..335 CDD:275368 5/22 (23%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 4/19 (21%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 7/38 (18%)
zf-H2C2_2 439..463 CDD:290200 12/50 (24%)
C2H2 Zn finger 454..475 CDD:275368 9/20 (45%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 10/33 (30%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 100..120 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.