DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ZNF335

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_071378.1 Gene:ZNF335 / 63925 HGNCID:15807 Length:1342 Species:Homo sapiens


Alignment Length:518 Identity:112/518 - (21%)
Similarity:173/518 - (33%) Gaps:176/518 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKPAELLKDFPLAETSSQEMEIS 157
            |.:|.:|.|           |||   |:......::|.|:.| .|||       .|...:::.:.
Human   296 EEEGPEEED-----------DDD---IVDAGAIDDLEEDSDY-NPAE-------DEPRGRQLRLQ 338

  Fly   158 KRTTTTHLIQTKKNVEMEIPKQEFIDL-----GPILLEKNTSQLDMEDVLDELPQE--------- 208
            :.|.:|...:.:.....::|:.|..||     |..|:...:.|...|....|.|..         
Human   339 RPTPSTPRPRRRPGRPRKLPRLEISDLPDGVEGEPLVSSQSGQSPPEPQDPEAPSSSGPGHLVAM 403

  Fly   209 -ELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEEKAKR 272
             ::|:..:::..|.:..||     ...||..:.|.||                         .:|
Human   404 GKVSRTPVEAGVSQSDAEN-----AAPSCPDEHDTLP-------------------------RRR 438

  Fly   273 GRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLH------- 330
            ||......||.||      |:..:..:.:.|       ...|.||.....|...|:.|       
Human   439 GRPSRRFLGKKYR------KYYYKSPKPLLR-------PFLCRICGSRFLSHEDLRFHVNSHEAG 490

  Fly   331 --------------------KEGI--HQNVKPYICDSCGKQLKTITALNEHKLVHTESR------ 367
                                ||.:  |...|||.||.|.........:..|..||:..|      
Human   491 DPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSRDRKKRPDP 555

  Fly   368 -----PFECTVCKAGFKNRARLKAHYQIHA-EPSFVCNICGKKLQTRRTWNMHKVVHTE---ERR 423
                 .|.|.||...:..:.||..|.:.|: |...:|:.|||..:.|.|:.||.:.|.:   .||
Human   556 TPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCGKSFKKRYTFKMHLLTHIQAVANRR 620

  Fly   424 LKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYC--------------------GKSFAC----- 463
            .||:.|..:.:..|.|..|.|||...:|:.|::|                    .|.|||     
Human   621 FKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCPYRTFREDFLLSHVAVKHTGAKPFACEYCHF 685

  Fly   464 ----NANCRSHKL-----------KKHPQEVQQEDGARLPSR----LNVPTLDELRVMTQKLP 507
                ..|.|.|..           ::||:|.        |||    .::..::||:......|
Human   686 STRHKKNLRLHVRCRHASSFEEWGRRHPEEP--------PSRRRPFFSLQQIEELKQQHSAAP 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 57/230 (25%)
C2H2 Zn finger 314..335 CDD:275368 8/49 (16%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 439..463 CDD:290200 10/43 (23%)
C2H2 Zn finger 454..475 CDD:275368 9/60 (15%)
ZNF335NP_071378.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..228
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..442 39/197 (20%)
C2H2 Zn finger 467..487 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..517 CDD:275368 2/19 (11%)
zf-H2C2_2 509..534 CDD:290200 9/24 (38%)
C2H2 Zn finger 529..545 CDD:275370 1/15 (7%)
C2H2 Zn finger 564..584 CDD:275368 6/19 (32%)
zf-H2C2_2 577..600 CDD:290200 8/22 (36%)
zf-C2H2 590..612 CDD:278523 8/21 (38%)
C2H2 Zn finger 592..612 CDD:275368 8/19 (42%)
C2H2 Zn finger 623..643 CDD:275368 6/19 (32%)
C2H2 Zn finger 651..672 CDD:275368 2/20 (10%)
C2H2 Zn finger 680..699 CDD:275368 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..763 2/9 (22%)
PRK04654 <795..911 CDD:135173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1013
C2H2 Zn finger 1021..1041 CDD:275368
Involved in the interaction with CCAR2. /evidence=ECO:0000269|PubMed:19131338 1041..1342
C2H2 Zn finger 1049..1069 CDD:275368
zf-H2C2_5 1075..1097 CDD:290620
C2H2 Zn finger 1077..1097 CDD:275368
zf-H2C2_2 1089..1114 CDD:290200
C2H2 Zn finger 1105..1126 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.