DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ZFP64

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_060667.2 Gene:ZFP64 / 55734 HGNCID:15940 Length:681 Species:Homo sapiens


Alignment Length:424 Identity:91/424 - (21%)
Similarity:160/424 - (37%) Gaps:111/424 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TTHLIQTKKNVEM-EIPKQEFIDLGPILLEK--------------NTSQLDMEDVLDELPQEELS 211
            ||.|::...::.: .|.||:|.:|...:..|              :|.|...|:.:         
Human    20 TTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAAAPSTVQFVSEETV--------- 75

  Fly   212 QPRLDSTTSPASMENDVKSEMLDSCE-----GDDDFLPV---DGQLMDLVAVATTPNTLESTAEE 268
             |...:.|:..::.::.::..:.:.|     |...:||.   :.|...::::.....|.:.|...
Human    76 -PATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPTTPP 139

  Fly   269 KAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKV---DKTTTTCDICNKTLSSATALKLH 330
            ..|  |::|  |....:.:.:|      ..:.:||.:|:   || ...|::|.|..|....||.|
Human   140 AQK--RLNC--CYPGCQFKTAY------GMKDMERHLKIHTGDK-PHKCEVCGKCFSRKDKLKTH 193

  Fly   331 KEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH-AEP 394
            .. .|..||||.|.:|.......::||:|..:|::.|||:|.:|....:|.::|..|.:.| .:.
Human   194 MR-CHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHTGDA 257

  Fly   395 SFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHL-LSHTGL--------- 449
            .|.|.:|..|.:.......|..||:.|:..||:.|.........||:|: :.|:|.         
Human   258 PFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCEFCNVRCTMKGNLKSHIRIKHSGNNFKCPHCDF 322

  Fly   450 ----------------------------------------------RPYVCNYCGKSFACNANCR 468
                                                          ||:.||||.......:|..
Human   323 LGDSKATLRKHSRVHQSEHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLS 387

  Fly   469 SHKLKKH-----PQEVQQEDGARLPSRLNVPTLD 497
            .|..|.|     .:.::::|..|..|| .|..||
Human   388 KHMKKFHGDMVKTEALERKDTGRQSSR-QVAKLD 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 50/214 (23%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 5/20 (25%)
zf-H2C2_2 439..463 CDD:290200 11/79 (14%)
C2H2 Zn finger 454..475 CDD:275368 7/20 (35%)
ZFP64NP_060667.2 COG5048 <151..450 CDD:227381 66/279 (24%)
zf-H2C2_2 161..186 CDD:290200 8/25 (32%)
C2H2 Zn finger 177..197 CDD:275368 7/20 (35%)
zf-H2C2_2 190..211 CDD:290200 10/21 (48%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
zf-H2C2_2 217..239 CDD:290200 9/21 (43%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 261..281 CDD:275368 4/19 (21%)
zf-H2C2_2 273..297 CDD:290200 7/23 (30%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
zf-C2H2_6 425..450 CDD:290623
C2H2 Zn finger 427..447 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.