DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ZNF692

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_011542525.1 Gene:ZNF692 / 55657 HGNCID:26049 Length:625 Species:Homo sapiens


Alignment Length:438 Identity:91/438 - (20%)
Similarity:144/438 - (32%) Gaps:146/438 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 WTHIIKPIPALEMESDNVYQKPAELLKDFPLAETSSQEM-----EISKRTTTTHLIQTKKNVEME 175
            |...:.|.|:   |:......|....:.:....||.||:     |..:||....|..::.:....
Human   273 WGPSLSPTPS---EAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPSSEPDAPRL 334

  Fly   176 I-------PKQEFIDLGPILLEK-------NTSQLDMEDVLDELPQEELSQPRLDSTTSPASMEN 226
            :       ||:......|..|..       :.|.|...   ...|.|...||:|..|...|.   
Human   335 LPSPVTCTPKEGETPPAPAALSSPLAVPALSASSLSSR---APPPAEVRVQPQLSRTPQAAQ--- 393

  Fly   227 DVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAE-------EKAKRGRMDCE--KCGK 282
              ::|.|.|........|             ||...|.||:       :.|||..|.|:  .||:
Human   394 --QTEALASTGSQAQSAP-------------TPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGR 443

  Fly   283 VYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYIC--DS 345
            ::.|| .|..|                                    ||:..|.:.|.:.|  .:
Human   444 IFSNR-QYLNH------------------------------------HKKYQHIHQKSFSCPEPA 471

  Fly   346 CGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIHAEPSFVCNICGKKLQTRRT 410
            |||.......|.||..:|:::|                           .::|..|.:..:|...
Human   472 CGKSFNFKKHLKEHMKLHSDTR---------------------------DYICEFCARSFRTSSN 509

  Fly   411 WNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSH----TGLRPYVCNYCGKSFACNANCRSHK 471
            ..:|:.:||.|:.|:|::||...::..:|..|...|    ..|| :.|.:|||.|....:..:|:
Human   510 LVIHRRIHTGEKPLQCEICGFTCRQKASLNWHQRKHAETVAALR-FPCEFCGKRFEKPDSVAAHR 573

  Fly   472 LKKH------PQE-----------------VQQEDGARLPSRLNVPTL 496
            .|.|      |||                 :...:|:|..:....|||
Human   574 SKSHPALLLAPQESPSGPLEPCPSISAPGPLGSSEGSRPSASPQAPTL 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 34/163 (21%)
C2H2 Zn finger 314..335 CDD:275368 2/20 (10%)
C2H2 Zn finger 343..363 CDD:275368 7/21 (33%)
C2H2 Zn finger 371..391 CDD:275368 0/19 (0%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
zf-H2C2_2 439..463 CDD:290200 10/27 (37%)
C2H2 Zn finger 454..475 CDD:275368 7/20 (35%)
ZNF692XP_011542525.1 zf-C2H2 465..489 CDD:278523 7/23 (30%)
C2H2 Zn finger 467..489 CDD:275368 7/21 (33%)
COG5048 490..>591 CDD:227381 28/128 (22%)
zf-C2H2 495..517 CDD:278523 4/21 (19%)
C2H2 Zn finger 497..517 CDD:275368 4/19 (21%)
zf-H2C2_2 509..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 525..545 CDD:275368 5/19 (26%)
C2H2 Zn finger 556..577 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.