DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and zgc:113030

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001018545.1 Gene:zgc:113030 / 553738 ZFINID:ZDB-GENE-050522-528 Length:240 Species:Danio rerio


Alignment Length:178 Identity:70/178 - (39%)
Similarity:90/178 - (50%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVH 363
            |:|.:.|:..:...||..|.|:.|.::.|..|.. ||...||:.|..|||.....::||:|.::|
Zfish     5 RKIHKMVRTGEKPITCTQCGKSFSQSSNLNRHMM-IHTGEKPFTCTQCGKSFTQSSSLNKHMMIH 68

  Fly   364 TESRPFECTVCKAGFKNRARLKAHYQIH-AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCD 427
            |..|||.||.|...|...:.|..|..|| .|..|.|..||:..:.....|.|.|:||.|:..:||
Zfish    69 TGERPFICTQCGKSFTRSSNLIEHMLIHTGEKPFTCTQCGRNFRQAAHLNQHIVIHTGEKPHRCD 133

  Fly   428 VCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKH 475
            .||..|.|...||.||..||..|||.|:.||||  |.   |...|.||
Zfish   134 QCGQTFARRSFLKFHLRVHTNERPYSCSVCGKS--CT---RQSSLIKH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 64/158 (41%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 10/19 (53%)
zf-H2C2_2 439..463 CDD:290200 14/23 (61%)
C2H2 Zn finger 454..475 CDD:275368 8/20 (40%)
zgc:113030NP_001018545.1 C2H2 Zn finger 20..40 CDD:275368 6/20 (30%)
COG5048 <25..204 CDD:227381 64/158 (41%)
zf-H2C2_2 32..57 CDD:290200 10/25 (40%)
C2H2 Zn finger 48..68 CDD:275368 7/19 (37%)
zf-H2C2_2 60..85 CDD:290200 12/24 (50%)
C2H2 Zn finger 76..96 CDD:275368 6/19 (32%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
zf-H2C2_2 116..141 CDD:290200 11/24 (46%)
C2H2 Zn finger 132..152 CDD:275368 10/19 (53%)
C2H2 Zn finger 160..180 CDD:275368 10/22 (45%)
C2H2 Zn finger 188..208 CDD:275368
zf-H2C2_2 200..225 CDD:290200
C2H2 Zn finger 216..236 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.