DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG1792

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:465 Identity:95/465 - (20%)
Similarity:147/465 - (31%) Gaps:186/465 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DELSSVLCTECYTLISELIDFAEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHI 119
            :||...:|:.|...:...|.|.|.|.:.|...:                                
  Fly    47 NELPPFICSPCELDLQTAIAFRERVIRTQKTLQ-------------------------------- 79

  Fly   120 IKPIPALEMESDNVYQKPAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDL 184
                     ||.|:..  |||::.|.:                        .||.||...|    
  Fly    80 ---------ESPNLGN--AELIESFAV------------------------GVEKEIQYAE---- 105

  Fly   185 GPILLEKNTSQLDMEDVLDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCE-GDDDFLPVDGQ 248
                      ::...:|:|.||:|.|    |:.|..|           .:.|| .:...:.|..|
  Fly   106 ----------EVTEIEVIDLLPEEHL----LEETEEP-----------YEICEQNEQPQVKVPAQ 145

  Fly   249 LMDL-VAVATTPNTLES-----------------TAEE----KAKRGRMD--CEKCGKVYRNRAS 289
            ...| .:..|||....|                 |.:|    |.:|.:.|  ||:||:.:...::
  Fly   146 EKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSN 210

  Fly   290 YEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTIT 354
            ::.||.|                                      |..||.:.||.|.:|..|.|
  Fly   211 FKLHLLR--------------------------------------HTGVKSFACDQCSQQFYTAT 237

  Fly   355 ALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIHAEPSFVCNICGKKLQTRRTWNMHKVVHT 419
            .|..|:.:|..:..|:|..|:|.:.|.:....|                          .::.||
  Fly   238 LLRRHQELHAGNALFQCRYCEATYSNASGRIQH--------------------------ERMRHT 276

  Fly   420 EERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSH-KLKKHPQEVQQED 483
            ..:...|..|...|..|..|:||:|||||:|.:.|:.|..||...::..|| :.|.|......:.
  Fly   277 NVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQA 341

  Fly   484 GARLPSRLNV 493
            ....|..|:|
  Fly   342 ALDNPVELDV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 9/31 (29%)
COG5048 <313..471 CDD:227381 39/158 (25%)
C2H2 Zn finger 314..335 CDD:275368 0/20 (0%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 0/19 (0%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 439..463 CDD:290200 13/23 (57%)
C2H2 Zn finger 454..475 CDD:275368 7/21 (33%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 9/73 (12%)
C2H2 Zn finger 198..218 CDD:275368 7/57 (12%)
C2H2 Zn finger 226..243 CDD:275368 7/16 (44%)
C2H2 Zn finger 254..275 CDD:275368 5/46 (11%)
zf-C2H2 281..303 CDD:278523 8/21 (38%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 296..320 CDD:290200 13/23 (57%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.