DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG8319

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:351 Identity:88/351 - (25%)
Similarity:138/351 - (39%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 QEFIDLGPILLEKNTSQLDME-DVLDELPQEELSQPRLDSTTS---PASMENDVKSEMLDSCEG- 238
            :|::| |..|.|...:..|:: |..|.:||:.......|:.|:   ....|.:.|...|....| 
  Fly    24 EEYVD-GAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTAYGFKRRCEENYKKFYLAILNGQ 87

  Fly   239 -------DDDFL----PVDGQL------------MDLVAVATTPNTLESTAE----EKAKRGRMD 276
                   ::|||    |..|.|            ....|..||.:::.::..    ...|.....
  Fly    88 VIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFK 152

  Fly   277 CEKCGKVYRNRASYEKHLE-----RECRRIERR--VKVD----------KTTTTCDICNKTLSSA 324
            ||.|.|.::.:.:...|::     ..|:..|.|  .|.|          .:|..|..|.|..||.
  Fly   153 CELCIKQFKRQINLLDHMKVHSNSHVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSST 217

  Fly   325 TALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESR----PFECTVCKAGFKNRARLK 385
            .:|..||....|...|:.|..|.:.......|..|.|:|.||:    |.:|:.|:.||.|::.||
  Fly   218 QSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALK 282

  Fly   386 AHYQIH-AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGL 449
            .|...| .|....|..|....::::...:|..:||.|:..:|..|...|..:..|..|...|:..
  Fly   283 VHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDE 347

  Fly   450 RPYVCNYCGKSFACNANCRSHKLKKH 475
            |||.|:.|.:.|....:.:.|.|.||
  Fly   348 RPYKCSICLQDFREKHHLKRHFLGKH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 47/162 (29%)
C2H2 Zn finger 314..335 CDD:275368 8/20 (40%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
zf-H2C2_2 439..463 CDD:290200 9/23 (39%)
C2H2 Zn finger 454..475 CDD:275368 5/20 (25%)
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 14/55 (25%)
COG5048 <153..368 CDD:227381 58/214 (27%)
C2H2 Zn finger 153..173 CDD:275368 5/19 (26%)
C2H2 Zn finger 179..196 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..227 CDD:275370 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 3/19 (16%)
zf-H2C2_2 308..332 CDD:290200 6/23 (26%)
zf-C2H2 322..344 CDD:278523 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..368 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.