DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and M1BP

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:510 Identity:104/510 - (20%)
Similarity:175/510 - (34%) Gaps:137/510 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HWLNWCRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDE--LSSVLCTECYTL 68
            |..:.||:|||..::.........::....||:..:       ..::||:.  |...:|..|...
  Fly     8 HLKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEAL-------TGLRLENYGCLPDQICECCSME 65

  Fly    69 ISELIDFAEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNV 133
            ::..:...|.....|... :|..||   :|...::|..:...:.:|    |::.:..  .:.|.|
  Fly    66 LASAVKLRERCIAAQREL-LLGLTE---EQRQGISAFYRAAVMGED----IVQTVKT--PDDDEV 120

  Fly   134 YQKPAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDM 198
            |....|::.:.|..|....::|..             |...|:            .|.:..:.|.
  Fly   121 YATYQEIVLEEPKEEIDDTKVEYD-------------NTYYEV------------AEGHAGEDDA 160

  Fly   199 EDVLDE------LPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMD------ 251
            ..:::|      :.::|..|..|:.......:..||....:  .:.||:...:|..|.|      
  Fly   161 ASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAYV--YDSDDEVAVLDNVLDDEYEHEN 223

  Fly   252 -LVAVATTPNTLESTAEEKAKRGR---MDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTT 312
             :|...:.|...:..:::..:||.   ..||:||...:.|.::|.|    |||            
  Fly   224 IVVKKCSLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELH----CRR------------ 272

  Fly   313 TCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAG 377
                                  |:..|.:.|:.|..:..|.:.|..|...||..||         
  Fly   273 ----------------------HRGDKQFGCELCQSRFCTTSELKRHMRKHTGERP--------- 306

  Fly   378 FKNRARLKAHYQIHAEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTH 442
                              |.|..||:......|...|:..||.||...|..||..|.....||.|
  Fly   307 ------------------FACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNH 353

  Fly   443 LLSHTGLRPYVCNYCGKSFA----CNANCRSHKLKKH------PQEVQQEDGARL 487
            :|.|:|.|.|.|..|.|||.    .:.:.||...|:|      .|.::||....|
  Fly   354 MLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVLEQEQKREL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 14/78 (18%)
COG5048 <313..471 CDD:227381 40/161 (25%)
C2H2 Zn finger 314..335 CDD:275368 0/20 (0%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 0/19 (0%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 439..463 CDD:290200 13/27 (48%)
C2H2 Zn finger 454..475 CDD:275368 8/24 (33%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 14/78 (18%)
C2H2 Zn finger 253..273 CDD:275368 10/57 (18%)
COG5048 276..>331 CDD:227381 17/81 (21%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 293..317 CDD:290200 10/50 (20%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
zf-H2C2_2 324..346 CDD:290200 9/21 (43%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
zf-H2C2_2 350..372 CDD:290200 11/21 (52%)
C2H2 Zn finger 365..383 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.