DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ranshi

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:456 Identity:98/456 - (21%)
Similarity:161/456 - (35%) Gaps:143/456 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRLCAKDDAHGNVKVQMN---ENSQGNWDNVLIM--AIRKYFEVQMQLEDELSSVLCTECYTLIS 70
            ||.|.|   ..|.:..:|   :.:|...:::.::  |:.|....       |.:.||..|.|.:.
  Fly     6 CRTCGK---RTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCST-------LPNRLCASCQTCLQ 60

  Fly    71 ELIDFAEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQ 135
            :.|.|.|...:||.  |:|...:                   |:|:..|.:..|...:|.:.:  
  Fly    61 QAISFRERCLEVQR--ELLHSQD-------------------DEDFLRICQESPKSVLEQEEL-- 102

  Fly   136 KPAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMED 200
                   :..|||                       :.:|:.:.:.::.|||    .:|...:||
  Fly   103 -------ELDLAE-----------------------ISIEVERLDDLNEGPI----QSSGFKVED 133

  Fly   201 VLDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLEST 265
            :|:|....| .:|                     :.|.|.|:..:|..:.:..........|:|.
  Fly   134 ILNESKINE-DEP---------------------NNEDDIDYSEMDYLIYESDTEVDAKQELKSD 176

  Fly   266 AEE-KAKRGRMD---------CEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKT 320
            :|. |.:|.|.:         ||:||...::|.|:..|    |:|                    
  Fly   177 SENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILH----CKR-------------------- 217

  Fly   321 LSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLK 385
                          |:.||.:.|:.|..:..|...|..|...||..:||:|..|...|.:.:...
  Fly   218 --------------HRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRL 268

  Fly   386 AHYQIHA-EPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGL 449
            .|.:.|. |..|||..|.....|......|.:|||.|:..:||:|..||.|...|.||..|:...
  Fly   269 KHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHR 333

  Fly   450 R 450
            |
  Fly   334 R 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 19/80 (24%)
COG5048 <313..471 CDD:227381 39/139 (28%)
C2H2 Zn finger 314..335 CDD:275368 0/20 (0%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 4/19 (21%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 9/19 (47%)
zf-H2C2_2 439..463 CDD:290200 5/12 (42%)
C2H2 Zn finger 454..475 CDD:275368
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 20/82 (24%)
C2H2 Zn finger 198..218 CDD:275368 9/57 (16%)
COG5048 222..>276 CDD:227381 15/53 (28%)
C2H2 Zn finger 226..246 CDD:275368 5/19 (26%)
zf-H2C2_2 238..262 CDD:290200 8/23 (35%)
C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
zf-H2C2_2 269..291 CDD:290200 7/21 (33%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
zf-H2C2_2 295..319 CDD:290200 10/23 (43%)
C2H2 Zn finger 310..328 CDD:275368 9/17 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.