DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and CG8159

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:512 Identity:113/512 - (22%)
Similarity:171/512 - (33%) Gaps:157/512 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NWCRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELI 73
            |.||:||....:.......|..:     ..::..|.....|.:|.|..|...:|..|.|.:...|
  Fly     4 NVCRVCASSTDNSKSLKLFNSGA-----CKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAI 63

  Fly    74 DFAEHVTKVQDIF-EVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKP 137
            .|.:...:.|.|| |.|.|.|.|..:.....:.|.|                 .:...|...:.|
  Fly    64 SFRDRCLRSQKIFEESLVRNEEDTFRSSVRRSARSQ-----------------RQRHEDTAPKTP 111

  Fly   138 AELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVL 202
            |.     ||        |:.                             |.||..::..:.:|.:
  Fly   112 AS-----PL--------EVM-----------------------------IKLESLSNGDEEDDGI 134

  Fly   203 DELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAE 267
            |.|           .:.:.|.||..:|: |..|.|.|.               .|:|..|:.|..
  Fly   135 DHL-----------DSCNEADMELAIKA-MSSSTEDDG---------------TTSPVRLKRTRR 172

  Fly   268 EKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKE 332
            ...|:|       ||.                  |.|.||                         
  Fly   173 RGLKKG-------GKG------------------ENRTKV------------------------- 187

  Fly   333 GIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH-AEPSF 396
                .:..:.||.||..:...::.:.|...|:..|||:|.:|.|.|.:...||.|..:| .:..|
  Fly   188 ----TLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKF 248

  Fly   397 VCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSF 461
            .|..|.:..........|:..||.:|...|..||..|..|..||.|:|.|||.|.:.|..|.:||
  Fly   249 QCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSF 313

  Fly   462 ACNANCRSH---KLKKHPQEVQQED--GARL-PSRLNVPTLDELRVMTQKLPKGTTE 512
            |...:.::|   ...||..|....|  |.:| ||:    :.|:::.:|:|.|:...:
  Fly   314 ARPTHLKTHFRSNTHKHNLEKSMADAGGVQLSPSQ----SADQVKFVTEKEPEAEAD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 18/77 (23%)
COG5048 <313..471 CDD:227381 43/161 (27%)
C2H2 Zn finger 314..335 CDD:275368 0/20 (0%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 9/19 (47%)
zf-H2C2_2 439..463 CDD:290200 12/23 (52%)
C2H2 Zn finger 454..475 CDD:275368 6/23 (26%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 18/77 (23%)
C2H2 Zn finger 194..214 CDD:275368 5/19 (26%)
COG5048 <197..322 CDD:227381 40/124 (32%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 7/19 (37%)
C2H2 Zn finger 250..270 CDD:275368 3/19 (16%)
zf-H2C2_2 265..287 CDD:290200 8/21 (38%)
C2H2 Zn finger 278..298 CDD:275368 9/19 (47%)
zf-H2C2_2 291..315 CDD:290200 12/23 (52%)
C2H2 Zn finger 306..328 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.