DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17568 and ouib

DIOPT Version :9

Sequence 1:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:110/266 - (41%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLEREC 298
            ||..||:|               |..|:            .::.|||.     .:.:.|..|.|.
  Fly    82 DSSSGDED---------------TNDNS------------ELESEKCA-----FSDFGKKKEGEL 114

  Fly   299 RRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKP---------------YICDSCGK 348
            .....:|.:::     :..:|||:.....:|.::||.:...|               |||:.||.
  Fly   115 VEETFQVLIEE-----EPMDKTLNRDAKAQLREDGIDEKCVPSQKIIKVSTKLDDQIYICELCGT 174

  Fly   349 QLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH-AEPSFVCNICGKKLQTRRTWN 412
            ...:......|...|...|||.|..|.|.|.:...|:||:::| .|..|.|..|.|:..:.....
  Fly   175 HATSKPTFQRHMRKHRGERPFGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRL 239

  Fly   413 MHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSH-KLKKHP 476
            :|:..||.:|...|:.||..|..:..||.|::.|||.|.:.|:.|.:||...|:..:| :...|.
  Fly   240 IHERTHTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRSFQRKAHLVTHTRSMMHL 304

  Fly   477 QEVQQE 482
            |.|:::
  Fly   305 QNVKKQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 51/174 (29%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 439..463 CDD:290200 11/23 (48%)
C2H2 Zn finger 454..475 CDD:275368 6/21 (29%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871
COG5048 <158..300 CDD:227381 44/141 (31%)
C2H2 Zn finger 169..189 CDD:275368 4/19 (21%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 209..234 CDD:290200 9/24 (38%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
zf-H2C2_2 241..262 CDD:290200 8/20 (40%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.